8IX7A

Functional significance of serine 13 in the active site of rice phi-class glutathione s-transferase f3.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
VTVYGPMISPAVARVAACLLEKDVPFQVEPVDMSKGEHKSPSFLKLQPFGQVPAFKDSLTTVFESRAICRYICDQYADSGNKTLMGRKEDGVVGRAAIEKWIEAEGQSFNPPSLAMAFQLAFAPFMGRATDMAVVEQNEAKLVKVLDVYEQWLGENQYFAGDEFSLADLVHMPNTDLLVRKTNKAGLFTERKNLARWWDEVSARPSWKKVVELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional significance of serine 13 in the active site of rice Phi-class glutathione S-transferase F3.
rcsb
molecule keywords glutathione transferase
molecule tags Plant protein
source organism Oryza sativa subsp. indica
total genus 81
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...