8J48B

Crystal structure of ga
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APHEERVGDMRIVNITFSDINSIKNFQPFSQYFDFTLTGPRYNGNIAQFAMIWKIKNPPHNLLGVFFDNNTRDDEDDKYTLEELKQMGNGAKNMYIFWQYEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of SAP05-mediated ubiquitin-independent proteasomal degradation of transcription factors
doi rcsb
molecule keywords GATA transcription factor 18
molecule tags Plant protein
source organism Arabidopsis thaliana
total genus 24
structure length 103
sequence length 103
chains with identical sequence C
ec nomenclature ec ?:
pdb deposition date 2023-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...