8J5UA

Crystal structure of mycobacterium tuberculosis oppa complexed with an endogenous oligopeptide
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
534
structure length
534
Chain Sequence
ADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKATLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIHAISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTATPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAARLPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLAIAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGWRRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVNVGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARALANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRRHHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An oligopeptide permease, OppABCD, requires an iron-sulfur cluster domain for functionality
doi rcsb
molecule keywords Uncharacterized protein Rv1280c
molecule tags Peptide binding protein
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 171
structure length 534
sequence length 534
ec nomenclature
pdb deposition date 2023-04-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...