8P0MC

Crystal structure of tead3 in complex with iag933
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
207
Chain Sequence
RTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Direct and selective pharmacological disruption of the YAP–TEAD interface by IAG933 inhibits Hippo-dependent and RAS–MAPK-altered cancers
doi rcsb
molecule tags Transcription
source organism Homo sapiens
molecule keywords Transcriptional enhancer factor TEF-5
total genus 54
structure length 207
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-05-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...