8RBOE

Cryo-em structure of pyrococcus furiosus apo form rna polymerase contracted clamp conformation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
189
structure length
189
Chain Sequence
MYKIVTVKDVVRIPPTMFTMDPKEAAKIILRETYEGTYDKDEGVILSILEVKDIKDGIIIPGDGATYHEVVFDVLVWEPKIHEVVEGYVADVMPFGAFIRIGPIDGLVHISQLMDDYVVYDERNKQFVGKEKKYLLKIGDLVRARIINISAKSKVIRENRIGLTMRQPGLGKFEWIEKEKKKEKEEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment
rcsb
molecule tags Transcription
source organism Pyrococcus furiosus dsm 3638
molecule keywords DNA-directed RNA polymerase subunit Rpo1N
total genus 35
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2023-12-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...