8TSLC

S. thermodepolymerans kpsm-kpse in apo 2 state with rigid body fitted kpst
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
256
Chain Sequence
RSPWQIQQAVLFALFLRELKTRLGGRWLGVFWVLLEPVAHIAVMTTLFSLAHRAAMPSIEYPVFLITGLIPFFMFRGLVTRLMEAIDSNRGLFAYRQVKPIDTVIARAMLEISLQSIVYLIALGTLGWLGFHFLPVRALELAGVSAVLIMLGASLGLFFAVVTNEIPQARAIVRISLLPLYFVSGVIFPVHTIPPQYLPLLQLNPVLHLIELSRASFFPQYRVLQGINLAYPAGFALLSLFLALMLYRLRRHQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular insights into capsular polysaccharide secretion.
pubmed doi rcsb
molecule tags Membrane protein
source organism Caldimonas thermodepolymerans
molecule keywords Transport permease protein
total genus 81
structure length 256
sequence length 256
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-08-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...