8U0ZA

Crystal structure of the orotidine 5'-monophosphate decarboxylase domain of coffea arabica ump synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
260
Chain Sequence
FRLPYGERVRLAKNPTGKKLFEIMIQKETNLCLAADVATAAELLDIADKVGPEICMLKTHVDILPDFTPDFGSKLRSIAEKHNFLIFEDRKFADIGNTVTMQYEGGIFKILDWADIVNAHIVSGPGIVDGLKLKGLPRGRGLLLLAEMSSSGNFAKGDYTAAAVKIAEGHSDFVIGFISVNPASWPSGPGNPALIHATPGVQLAKGGDALGQQYNTPFSVISERGSDIIIVGRGIIKAANPAEVAREYRLQGWDAYLLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional properties of uridine 5'-monophosphate synthase from Coffea arabica.
pubmed doi rcsb
molecule tags Lyase
source organism Coffea arabica
molecule keywords Uridine 5'-monophosphate synthase
total genus 99
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-08-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...