8V2DA

Computational designed nanocage o43_129
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
307
structure length
307
Chain Sequence
DDLLLKLLELLVEQARVSAEFARRQGDEKMLEEVARKAEEVARKAESIARKARKEGNLELALKALEILVRAAHVLAEIARERGNEELQKKAHKLAKEALRQVIEIAIRAIQEGNLELAIIALHISVRIAEVLLETRPDDREEIREQQAIFELLIAALEAAIRLEKLKEEGAPPEQIERVAEHGLERLKEIAKEISKEVDSPESKRIAYKIVAAAAEFLLKILAEGGATPEQLERVTEHALEVLKEVAKELADSPESGLAALAAIASLAKLGLEQLKEIGAPPEQQRRVTKAGIEAVREIYRYGRKLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Blueprinting extendable nanomaterials with standardized protein blocks
doi rcsb
molecule keywords O43_129 component B
molecule tags De novo protein
source organism Synthetic construct
total genus 123
structure length 307
sequence length 307
chains with identical sequence C, D, E, F, G, H, I, L, M, N, O, P, Q, R, S, T, U, V, W, t, u, y, z
ec nomenclature
pdb deposition date 2023-11-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...