8V9OD

Imaging scaffold engineered to bind the therapeutic protein target bard1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
301
structure length
301
Chain Sequence
DSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTGGKGRTVTMDMIIYLIKRSVEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIKAASELTEINANVLLYANMLSNILFMHALISNKRKEELDKKLLEAARAGQDDEVAALLAKGADVNASDYKGTTPLHVAAWNGHLEIVDVLLARGADINASDSYGDTPLHLAANYGHLEIVDLLLRWGADVNASDSSGKTPLHLAAQDGHLEIVDVLLAHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of a designed rigidified imaging scaffold engineered to bind the therapeutic protein target BARD1
rcsb
molecule keywords Tetrahedral Nanocage Cage, Non-Fusion Component
molecule tags De novo protein
source organism Synthetic construct
total genus 105
structure length 301
sequence length 301
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2023-12-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...