8XY8A

A beta-lactamase - ampc
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
360
structure length
360
Chain Sequence
ATQDGIQRTVDAAIRPLMAKDGIHGMAVGIVAGGKAYVYNYGVASAETGKPVTRDTLFELGSISKTFTATLASYAQVSGNLSLSDTTGKYLPVLQGSQFGNVKLINLGTHTPGGLPLQVPDEIHDNDELMQYFKAWRPSCVPGACRTYTNPGIGTLGLITAKSMGEDFTPLMEQRMFPALGLKNSYIDVPEARIPDYAQGYKKDGAPIRMAPGVLSAEAYGVKSTAADMTRFMQANMNLLPLDAKLQRAIMQTHTGYFKAGVLTQDLIWEQYAYPVALKTLLAGNSSAMALKATPAVEIKPPLAPRQDVWINKTGSTNGFGAYVAFVPEKQLGIVMLANKNFPNDERVSVAYKILTALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism-Guided Protein Engineering of Paraburkholderia xenovorans Lactamase for the Green Synthesis of 2-(2-oxopyrrolidin-1-yl)-butanoic acid
rcsb
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Paraburkholderia xenovorans
total genus 113
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: beta-lactamase.
pdb deposition date 2024-01-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...