8ZOLD

Cryo-em strcuture of cas5-hnh cascade,conf3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
157
structure length
112
Chain Sequence
YNPEFKAGQLLRFRLRVNASVRRHKRVSLTWDASSTPDQALADWLAAKSPKLGFTLQRCELLQLGWVYGRFRAALLEGVLEVDDPKLFLKTLSSGIGKAKSFGFGLLSVLPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for RNA-guided DNA degradation by Cas5-HNH/Cascade complex.
pubmed doi rcsb
molecule keywords RNA (61-MER)
molecule tags Immune system/rna
source organism Candidatus cloacimonetes bacterium adurb.bin088
total genus 15
structure length 112
sequence length 157
ec nomenclature ec 3.1.-.-:
pdb deposition date 2024-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...