8ZVKA

Crystal structure of the gh5 domain from a processive endoglucanase of acetivibrio alkalicellulosi
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
306
structure length
306
Chain Sequence
DFVGTHGQLQVIGNQLCNQYGQPIQLRGMSSHGLQWYPQFVNYDSIKWLRDDWGITVFRAAMYTDSQGYISNPSVKNKVIEAVEACIALGIYVIIDWHILADGNPNQYKEQAKDFFREMATRYGNYPNVIYEICNEPNGPVNWNNHIKPYAEEVIPVIRSIDRNNIVIVGTGTWSQDIHDAANNQLSFDNVMYALHFYAGTHGQNLRSRIDYAMSRGAAIFVSEWGVSDASGDGGVFLSQSDVWLDFLNERNVSWVNWSLTHKVESSAALNPGASPNGGWTDANLSPSGRYVKSAMRKNYNPPVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title His 70 of Acetivibrio alkalicellulosi Cel5A is important for efficient hydrolysis of short cellodextrins.
pubmed doi rcsb
molecule keywords AaBgIC
molecule tags Hydrolase
source organism Acetivibrio alkalicellulosi
total genus 126
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2024-06-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...