966CA

Crystal structure of fibroblast collagenase-1 complexed to a diphenyl-ether sulphone based hydroxamic acid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
157
Chain Sequence
b'RWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MMP-1
publication title Crystal structures of MMP-1 and -13 reveal the structural basis for selectivity of collagenase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Matrix metalloprotease
total genus 42
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1998-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 966cA00
2X3BA 4PKVA 2PJTA 3NX7A 1HV5A 5BOYA 4IJOA 1JIZA 4Q1LA 3WV1A 1AYKA 4JA1A 830CA 2QPJA 2MLSA 1YP1A 3LQBA 3LQ0A 2AYKA 3HY7A 4ON1A 3HYGA 4DV8A 1OMJA 4WKEA 1JAQA 2OZRA 1G4KA 1XFUA 4PKRA 2OW1A 4I35A 1CGEA 1OM6A 4H1QA 1CXVA 1WNIA 2JT6A 3EDZA 2OVZA 1R55A 2EROA 1ATLA 1PWVA 2OXWA 2DDFA 1G12A 4H49A 2CLTA 4H82A 2AIGP 3B8ZA 3DWBA 1D5JA 2A8HA 4L19A 4H30A 1XFYA 5CZMA 1ZXCA 5D2BA 1GE5A 3HBUP 1HY7A 2XS3A 1CAQA 1QJJA 1SATA 3Q2GA 2DDYA 1Y8JA 3LIRA 2L0RA 4XM8A 1ZS0A 3HB2P 1L6JA 1GKCA 1XUDA 1OS9A 1BQOA 3MA2A 2JSDA 1HTDA 4GQLA 2JT5A 1OS2A 3LKAA 3F18A 2X3CA 2MZHA 1RMZA 1CQRA 3DL1A 2O3EA 2ERQA 3F16A 4FXQA 2TCLA 5H8XA 3LJGA 1EUBA 1XURA 1KUKA 4FVLA 5B5OA 1RM8A 4DPEA 1R54A 1R1IA 5BOTA 5I4OA 2N8RA 2Y6CA 1OM7A 4AXQA 4JPAA 1C8TA 1AKLA 4FU4A 1C3IA 3OHOA 1K7GA 1BQQM 1Y0VA 1GO8P 1JKYA 1ZXVA 1JAPA 1IACA 3N2UA 3K7NA 3F17A 3F15A 4L63A 2Z2DA 2W15A 5D3CA 4IN9A 3USNA 1K7QA 2RJQA 1I76A 4XBHA 3LJZA 3B2ZA 4L6TA 1O0TA 3KMEA 4DF9A 2POJA 3L0VA 4H84A 1CGFA 2OI0A 4FXYP 5I0LA 4PKTA 3Q2HA 5D1SA 3WV3A 1A86A 1QJIA 1JANA 3VI1A 1UMSA 2FV5A 3KMCA 4WKIA 4J4MA 1JK3A 1CK7A 2YIGA 3ZUKA 1EB6A 3EDGA 1IAEA 1KUGA 3AYUA 3F1AA 3KEJA 3EHYA 5I12A 3RTTA 2W13A 2D1OA 3DPFA 1XFXA 3ZXHA 1JJ9A 3KECA 3SHIA 1D7XA 2KRJA 1ND1A 5D7WA 5BPAA 1SMPA 3HDBA 5I3MA 1QIBA 4R3VA 1UTZA 1BUVM 2Y6DA 3K7LA 5L7FA 1USNA 3KHIA 1G05A 2K2GA 1H71P 2OXUA 1K7IA 4PKQA 5CUHA 1DMTA 1IAGA 3KEKA 4XM7A 3EDIA 1XFVA 2J0TA 3ELMA 4H2EA 1PWQA 1GKDA 4IUWA 4HX3A 1QUAA 3U1RA 3B92A 1JH1A 1GE7A 3LILA 456CA 2I47A 4GWMA 3F19A 1MNCA 4AYKA 4I03A 4A3WA 1B3DA 5L79A 1R1HA 4GF1A 3KRYA 3TT4A 1XFWA 1MMBA 1FM1A 3LUMA 4XM6A 1IABA 2DW0A 3LE9A 2E3XA 1C7KA 2JIHA 2OW9A 1IAAA 966CA 1BKCI 2MZIA 2K9CA 3KWVC 3N2VA 1MMPA 4JIJA 1MMQA 4JP4A 1S4BP 4PKSA 2MZEA 5CXAA 4G0DA 3TSKA 1IADA 1ZTQA 1MMRA 4H76A 1UTTA 5JMYA 1YQYA 4ZR5A 2V4BA 1KUHA 2J83A 2OY2A 1GXDA 2X3AA 5B5PA 4ILWD 4DD8A 4HMAA 1AF0A 1UMTA 1QICA 4QKZA 1HFCA 1R1JA 3LJTA 1OO9A 2E2DA 1O0QA 1YOUA 4XCTA 2DW2A 4WK7A 5I43A 1BUDA 1JIWP 4GR3A 3TS4A 1BKCE 1UEAA 2OXZA 3AIGA 3LEAA 1SLMA 2MLRA 2O36A 1A85A 3LIKA 3ZVSA 3WV2A 1KAPP 1FBLA 4AIGA 1BM6A 3P24A 1PWPA 3LMCA 1DTHA 1BZSA 3DPEA 4GR0A 1BIWA 1QIAA 1PWUA 5D1UA 2DW1A 4GWNA 3DSLA 1XUCA 4GUYA 4JQGA 4EFSA 4CTHA 2FV9A 3OHLA 1EAKA 4AUOA 2WOAA 3RTSA 2D1NA 3L0TA 1Y93A 1CIZA 3BA0A 3HY9A 1JAOA 3DNGA 4WZVA 1XFZA 4PKWA 3E8RA 2RJPA 1KUFA 3LK8A 1SU3A 1YCMA 2SRTA 2USNA 4H3XA 2ERPA 4A7BA 5I2ZA 1Q3AA 2W12A 1ZVXA 1FLSA 3O2XA 1GO7P 2YB9A 1G9KA 1KUIA 1ROSA 1Z3JA 1D8FA 1I73A 3LUNA 1BKCA 1HOVA 1CGLA 2W14A 4G9LA 3VTGA 2OW2A 5LABA 3HBVP 2OY4A 1HFSA 4PKUA 2JNPA 1SRPA 4WF6A 3LGPA 2W0DA 3TVCA 1ZP5A 3G42A 1OM8A 2OW0A 5D1TA 1J7NA 3EWJA 1D8MA 1GE6A 3V96B 2X7MA 1SLNA 2OVXA 3HDAP 3I7IA 3GBOA 2WO9A 3AYKA 3P1VA 3CKIA 1G49A 3G5CA 3EDHA 3O64A 4GR8A 2CKIA 1ASTA 2HU6A 1PWWA 1BSWA 1B8YA 1I1IP 2XS4A 3I7GA 3EHXA 1KBCA 2WO8A 3UVCA
chains in the Genus database with same CATH superfamily
2X3BA 4PKVA 2PJTA 3NX7A 1HV5A 5BOYA 4IJOA 1JIZA 4Q1LA 3WV1A 1AYKA 4JA1A 830CA 2QPJA 2MLSA 1YP1A 3LQBA 3LQ0A 2AYKA 3HY7A 4ON1A 3HYGA 4DV8A 1OMJA 4WKEA 1JAQA 2OZRA 1G4KA 1XFUA 4PKRA 2OW1A 4I35A 1CGEA 1OM6A 4H1QA 1CXVA 1WNIA 2JT6A 3EDZA 2OVZA 1R55A 2EROA 1ATLA 1PWVA 2OXWA 2DDFA 1G12A 4H49A 2CLTA 4H82A 2AIGP 3B8ZA 3DWBA 1D5JA 2A8HA 4L19A 4H30A 1XFYA 5CZMA 1ZXCA 5D2BA 1GE5A 3HBUP 1HY7A 2XS3A 1CAQA 3DTIA 1QJJA 1SATA 3Q2GA 2DDYA 1Y8JA 3LIRA 2L0RA 4XM8A 1ZS0A 3HB2P 1L6JA 1GKCA 1XUDA 1OS9A 1BQOA 3MA2A 2JSDA 1HTDA 4GQLA 2JT5A 1OS2A 3LKAA 3F18A 2X3CA 2MZHA 1RMZA 4L7AA 1CQRA 3DL1A 2O3EA 2ERQA 3F16A 4FXQA 2TCLA 5H8XA 3LJGA 1EUBA 1XURA 1KUKA 4FVLA 5B5OA 1RM8A 4DPEA 1R54A 1R1IA 5BOTA 5I4OA 2N8RA 2Y6CA 1OM7A 4AXQA 4JPAA 1C8TA 1AKLA 4FU4A 1C3IA 3OHOA 1K7GA 1BQQM 1Y0VA 1GO8P 1JKYA 1OZ9A 1ZXVA 1JAPA 1IACA 3N2UA 3K7NA 3F17A 3F15A 4L63A 2Z2DA 2W15A 5D3CA 4IN9A 3USNA 1K7QA 2RJQA 1I76A 4XBHA 3LJZA 3B2ZA 4L6TA 1O0TA 3KMEA 4DF9A 2POJA 3L0VA 4H84A 1CGFA 2OI0A 4FXYP 5I0LA 4PKTA 3Q2HA 5D1SA 3WV3A 1A86A 1QJIA 1JANA 3VI1A 1UMSA 2FV5A 3KMCA 4WKIA 4J4MA 1JK3A 1CK7A 2YIGA 3ZUKA 1TVIA 1EB6A 3EDGA 1IAEA 1KUGA 3AYUA 3F1AA 3KEJA 3EHYA 5I12A 3RTTA 2W13A 2D1OA 3DPFA 1XFXA 3ZXHA 1JJ9A 3KECA 3SHIA 1D7XA 2KRJA 1ND1A 5D7WA 5BPAA 1SMPA 3HDBA 5I3MA 1QIBA 4R3VA 1UTZA 1BUVM 2Y6DA 3K7LA 5L7FA 1USNA 3KHIA 1G05A 2K2GA 1H71P 2OXUA 1K7IA 4PKQA 5CUHA 1DMTA 1IAGA 3KEKA 4XM7A 3EDIA 1XFVA 2J0TA 3ELMA 4H2EA 1PWQA 1GKDA 4IUWA 4HX3A 1QUAA 3U1RA 3B92A 1JH1A 1GE7A 3LILA 456CA 2I47A 1XAXA 4GWMA 2YUFA 3F19A 1MNCA 4AYKA 4I03A 4A3WA 1B3DA 5L79A 1R1HA 4GF1A 3KRYA 3TT4A 1XFWA 1MMBA 1FM1A 3LUMA 4XM6A 1IABA 2DW0A 3LE9A 2E3XA 1C7KA 2JIHA 2OW9A 1IAAA 966CA 1BKCI 2MZIA 2K9CA 3KWVC 3N2VA 1MMPA 4JIJA 1MMQA 4JP4A 1S4BP 4PKSA 2MZEA 5CXAA 4G0DA 3TSKA 1IADA 1ZTQA 1MMRA 4H76A 1UTTA 5JMYA 1YQYA 4ZR5A 2V4BA 1KUHA 2J83A 2OY2A 1GXDA 2X3AA 5B5PA 4ILWD 4DD8A 4HMAA 1AF0A 1UMTA 1QICA 4QKZA 1HFCA 1R1JA 3LJTA 1OO9A 2E2DA 1O0QA 1YOUA 4XCTA 2DW2A 4WK7A 3DTKA 5I43A 1BUDA 1JIWP 4GR3A 3TS4A 1BKCE 1UEAA 2OXZA 3AIGA 3LEAA 1SLMA 2MLRA 2O36A 1A85A 3LIKA 3ZVSA 3WV2A 1KAPP 1FBLA 4AIGA 1BM6A 3P24A 1PWPA 3LMCA 1DTHA 1BZSA 3DPEA 4GR0A 1BIWA 1QIAA 1PWUA 5D1UA 2DW1A 4GWNA 3DSLA 1XUCA 4GUYA 4JQGA 4EFSA 4CTHA 2FV9A 3OHLA 1EAKA 4AUOA 2WOAA 3RTSA 2D1NA 3L0TA 1Y93A 1CIZA 3BA0A 3HY9A 1JAOA 3DNGA 4WZVA 1XFZA 4PKWA 3E8RA 2RJPA 1KUFA 3LK8A 1SU3A 1YCMA 2SRTA 2USNA 4H3XA 2ERPA 4A7BA 5I2ZA 1Q3AA 2W12A 1ZVXA 1FLSA 3O2XA 1GO7P 2YB9A 1G9KA 1KUIA 1ROSA 1Z3JA 1D8FA 1I73A 3LUNA 1BKCA 1HOVA 1CGLA 2W14A 4G9LA 3VTGA 2OW2A 5LABA 3DTEA 3HBVP 2OY4A 1HFSA 4PKUA 2JNPA 1SRPA 4WF6A 3LGPA 2W0DA 3TVCA 1ZP5A 3G42A 1OM8A 2OW0A 5D1TA 1J7NA 3EWJA 1D8MA 1GE6A 3V96B 2X7MA 1SLNA 2OVXA 3HDAP 3I7IA 3GBOA 2WO9A 3AYKA 3P1VA 3CKIA 1G49A 3G5CA 3EDHA 3O64A 4GR8A 2CKIA 1ASTA 1XM5A 2HU6A 1PWWA 1BSWA 1B8YA 1I1IP 2XS4A 3I7GA 3EHXA 1KBCA 2WO8A 3UVCA
chains in the Genus database with same CATH topology
2X3BA 4PKVA 2PJTA 3NX7A 1HV5A 5BOYA 4IJOA 1JIZA 4Q1LA 3WV1A 1AYKA 4JA1A 830CA 2QPJA 2MLSA 1YP1A 3LQBA 3LQ0A 2AYKA 3HY7A 4ON1A 3HYGA 4DV8A 1OMJA 4WKEA 1JAQA 2OZRA 1G4KA 1XFUA 4PKRA 2OW1A 4I35A 1CGEA 1OM6A 4H1QA 1CXVA 1WNIA 2JT6A 3EDZA 2OVZA 1R55A 2EROA 1ATLA 1PWVA 2OXWA 2DDFA 1G12A 4H49A 2CLTA 4H82A 2AIGP 3B8ZA 3DWBA 1D5JA 2A8HA 4L19A 4H30A 1XFYA 5CZMA 1ZXCA 5D2BA 1GE5A 3HBUP 1HY7A 2XS3A 1CAQA 3DTIA 1QJJA 1SATA 3Q2GA 2DDYA 1Y8JA 3LIRA 2L0RA 4XM8A 1ZS0A 3HB2P 1L6JA 1GKCA 1XUDA 1OS9A 1BQOA 3MA2A 2JSDA 1HTDA 4GQLA 2JT5A 1OS2A 3LKAA 3F18A 2X3CA 2MZHA 1RMZA 4L7AA 1CQRA 3DL1A 2O3EA 2ERQA 3F16A 4FXQA 2TCLA 5H8XA 3LJGA 1EUBA 1XURA 1KUKA 4FVLA 5B5OA 1RM8A 4DPEA 1R54A 1R1IA 5BOTA 5I4OA 2N8RA 2Y6CA 1OM7A 4AXQA 4JPAA 1C8TA 1AKLA 4FU4A 1C3IA 3OHOA 1K7GA 1BQQM 1Y0VA 1GO8P 1JKYA 1ZXVA 1JAPA 1IACA 3N2UA 3K7NA 3F17A 3F15A 4L63A 2Z2DA 2W15A 5D3CA 4IN9A 3USNA 1K7QA 2RJQA 1I76A 4XBHA 3LJZA 3B2ZA 4L6TA 1O0TA 3KMEA 4DF9A 2POJA 3L0VA 4H84A 1CGFA 2OI0A 4FXYP 5I0LA 4PKTA 3Q2HA 5D1SA 3WV3A 1A86A 1QJIA 1JANA 3VI1A 1UMSA 2FV5A 3KMCA 4WKIA 4J4MA 1JK3A 1CK7A 2YIGA 3ZUKA 1EB6A 3EDGA 1IAEA 1KUGA 3AYUA 3F1AA 3KEJA 3EHYA 5I12A 3RTTA 2W13A 2D1OA 3DPFA 1XFXA 3ZXHA 1JJ9A 3KECA 3SHIA 1D7XA 2KRJA 1ND1A 5D7WA 5BPAA 1SMPA 3HDBA 5I3MA 1QIBA 4R3VA 1UTZA 1BUVM 2Y6DA 3K7LA 5L7FA 1USNA 3KHIA 1G05A 2K2GA 1H71P 2OXUA 1K7IA 4PKQA 5CUHA 1DMTA 1IAGA 3KEKA 4XM7A 3EDIA 1XFVA 2J0TA 3ELMA 4H2EA 1PWQA 1GKDA 4IUWA 4HX3A 1QUAA 3U1RA 3B92A 1JH1A 1GE7A 3LILA 456CA 2I47A 4GWMA 2YUFA 3F19A 1MNCA 4AYKA 4I03A 4A3WA 1B3DA 5L79A 1R1HA 4GF1A 3KRYA 3TT4A 1XFWA 1MMBA 1FM1A 3LUMA 4XM6A 1IABA 2DW0A 3LE9A 2E3XA 1C7KA 2JIHA 2OW9A 1IAAA 966CA 1BKCI 2MZIA 2K9CA 3KWVC 3N2VA 1MMPA 4JIJA 1MMQA 4JP4A 1S4BP 4PKSA 2MZEA 5CXAA 4G0DA 3TSKA 1IADA 1ZTQA 1MMRA 4H76A 1UTTA 5JMYA 1YQYA 4ZR5A 2V4BA 1KUHA 2J83A 2OY2A 1GXDA 2X3AA 5B5PA 4ILWD 4DD8A 4HMAA 1AF0A 1UMTA 1QICA 4QKZA 1HFCA 1R1JA 3LJTA 1OO9A 2E2DA 1O0QA 1YOUA 4XCTA 2DW2A 4WK7A 3DTKA 5I43A 1BUDA 1JIWP 4GR3A 3TS4A 1BKCE 1UEAA 2OXZA 3AIGA 3LEAA 1SLMA 2MLRA 2O36A 1A85A 3LIKA 3ZVSA 3WV2A 1KAPP 1FBLA 4AIGA 1BM6A 3P24A 1PWPA 3LMCA 1DTHA 1BZSA 3DPEA 4GR0A 1BIWA 1QIAA 1PWUA 5D1UA 2DW1A 4GWNA 3DSLA 1XUCA 4GUYA 4JQGA 4EFSA 4CTHA 2FV9A 3OHLA 1EAKA 4AUOA 2WOAA 3RTSA 2D1NA 3L0TA 1Y93A 1CIZA 3BA0A 3HY9A 1JAOA 3DNGA 4WZVA 1XFZA 4PKWA 3E8RA 2RJPA 1KUFA 3LK8A 1SU3A 1YCMA 2SRTA 2USNA 4H3XA 2ERPA 4A7BA 5I2ZA 1Q3AA 2W12A 1ZVXA 1FLSA 3O2XA 1GO7P 2YB9A 1G9KA 1KUIA 1ROSA 1Z3JA 1D8FA 1I73A 3LUNA 1BKCA 1HOVA 1CGLA 2W14A 4G9LA 3VTGA 2OW2A 5LABA 3DTEA 3HBVP 2OY4A 1HFSA 4PKUA 2JNPA 1SRPA 4WF6A 3LGPA 2W0DA 3TVCA 1ZP5A 3G42A 1OM8A 2OW0A 5D1TA 1J7NA 3EWJA 1D8MA 1GE6A 3V96B 2X7MA 1SLNA 2OVXA 3HDAP 3I7IA 3GBOA 2WO9A 3AYKA 3P1VA 3CKIA 1G49A 3G5CA 3EDHA 3O64A 4GR8A 2CKIA 1ASTA 2HU6A 1PWWA 1BSWA 1B8YA 1I1IP 2XS4A 3I7GA 3EHXA 1KBCA 2WO8A 3UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3B A;  4PKV A;  2PJT A;  3NX7 A;  1HV5 A;  5BOY A;  4IJO A;  1JIZ A;  4Q1L A;  3WV1 A;  1AYK A;  4JA1 A;  830C A;  2QPJ A;  2MLS A;  1YP1 A;  3LQB A;  3LQ0 A;  2AYK A;  3HY7 A;  4ON1 A;  3HYG A;  4DV8 A;  1OMJ A;  4WKE A;  1JAQ A;  2OZR A;  1G4K A;  1XFU A;  4PKR A;  2OW1 A;  4I35 A;  1CGE A;  1OM6 A;  4H1Q A;  1CXV A;  1WNI A;  2JT6 A;  3EDZ A;  2OVZ A;  1R55 A;  2ERO A;  1ATL A;  1PWV A;  2OXW A;  2DDF A;  1G12 A;  4H49 A;  2CLT A;  4H82 A;  2AIG P;  3B8Z A;  3DWB A;  1D5J A;  2A8H A;  4L19 A;  4H30 A;  1XFY A;  5CZM A;  1ZXC A;  5D2B A;  1GE5 A;  3HBU P;  1HY7 A;  2XS3 A;  1CAQ A;  1QJJ A;  1SAT A;  3Q2G A;  2DDY A;  1Y8J A;  3LIR A;  2L0R A;  4XM8 A;  1ZS0 A;  3HB2 P;  1L6J A;  1GKC A;  1XUD A;  1OS9 A;  1BQO A;  3MA2 A;  2JSD A;  1HTD A;  4GQL A;  2JT5 A;  1OS2 A;  3LKA A;  3F18 A;  2X3C A;  2MZH A;  1RMZ A;  1CQR A;  3DL1 A;  2O3E A;  2ERQ A;  3F16 A;  4FXQ A;  2TCL A;  5H8X A;  3LJG A;  1EUB A;  1XUR A;  1KUK A;  4FVL A;  5B5O A;  1RM8 A;  4DPE A;  1R54 A;  1R1I A;  5BOT A;  5I4O A;  2N8R A;  2Y6C A;  1OM7 A;  4AXQ A;  4JPA A;  1C8T A;  1AKL A;  4FU4 A;  1C3I A;  3OHO A;  1K7G A;  1BQQ M;  1Y0V A;  1GO8 P;  1JKY A;  1ZXV A;  1JAP A;  1IAC A;  3N2U A;  3K7N A;  3F17 A;  3F15 A;  4L63 A;  2Z2D A;  2W15 A;  5D3C A;  4IN9 A;  3USN A;  1K7Q A;  2RJQ A;  1I76 A;  4XBH A;  3LJZ A;  3B2Z A;  4L6T A;  1O0T A;  3KME A;  4DF9 A;  2POJ A;  3L0V A;  4H84 A;  1CGF A;  2OI0 A;  4FXY P;  5I0L A;  4PKT A;  3Q2H A;  5D1S A;  3WV3 A;  1A86 A;  1QJI A;  1JAN A;  3VI1 A;  1UMS A;  2FV5 A;  3KMC A;  4WKI A;  4J4M A;  1JK3 A;  1CK7 A;  2YIG A;  3ZUK A;  1EB6 A;  3EDG A;  1IAE A;  1KUG A;  3AYU A;  3F1A A;  3KEJ A;  3EHY A;  5I12 A;  3RTT A;  2W13 A;  2D1O A;  3DPF A;  1XFX A;  3ZXH A;  1JJ9 A;  3KEC A;  3SHI A;  1D7X A;  2KRJ A;  1ND1 A;  5D7W A;  5BPA A;  1SMP A;  3HDB A;  5I3M A;  1QIB A;  4R3V A;  1UTZ A;  1BUV M;  2Y6D A;  3K7L A;  5L7F A;  1USN A;  3KHI A;  1G05 A;  2K2G A;  1H71 P;  2OXU A;  1K7I A;  4PKQ A;  5CUH A;  1DMT A;  1IAG A;  3KEK A;  4XM7 A;  3EDI A;  1XFV A;  2J0T A;  3ELM A;  4H2E A;  1PWQ A;  1GKD A;  4IUW A;  4HX3 A;  1QUA A;  3U1R A;  3B92 A;  1JH1 A;  1GE7 A;  3LIL A;  456C A;  2I47 A;  4GWM A;  3F19 A;  1MNC A;  4AYK A;  4I03 A;  4A3W A;  1B3D A;  5L79 A;  1R1H A;  4GF1 A;  3KRY A;  3TT4 A;  1XFW A;  1MMB A;  1FM1 A;  3LUM A;  4XM6 A;  1IAB A;  2DW0 A;  3LE9 A;  2E3X A;  1C7K A;  2JIH A;  2OW9 A;  1IAA A;  966C A;  1BKC I;  2MZI A;  2K9C A;  3KWV C;  3N2V A;  1MMP A;  4JIJ A;  1MMQ A;  4JP4 A;  1S4B P;  4PKS A;  2MZE A;  5CXA A;  4G0D A;  3TSK A;  1IAD A;  1ZTQ A;  1MMR A;  4H76 A;  1UTT A;  5JMY A;  1YQY A;  4ZR5 A;  2V4B A;  1KUH A;  2J83 A;  2OY2 A;  1GXD A;  2X3A A;  5B5P A;  4ILW D;  4DD8 A;  4HMA A;  1AF0 A;  1UMT A;  1QIC A;  4QKZ A;  1HFC A;  1R1J A;  3LJT A;  1OO9 A;  2E2D A;  1O0Q A;  1YOU A;  4XCT A;  2DW2 A;  4WK7 A;  5I43 A;  1BUD A;  1JIW P;  4GR3 A;  3TS4 A;  1BKC E;  1UEA A;  2OXZ A;  3AIG A;  3LEA A;  1SLM A;  2MLR A;  2O36 A;  1A85 A;  3LIK A;  3ZVS A;  3WV2 A;  1KAP P;  1FBL A;  4AIG A;  1BM6 A;  3P24 A;  1PWP A;  3LMC A;  1DTH A;  1BZS A;  3DPE A;  4GR0 A;  1BIW A;  1QIA A;  1PWU A;  5D1U A;  2DW1 A;  4GWN A;  3DSL A;  1XUC A;  4GUY A;  4JQG A;  4EFS A;  4CTH A;  2FV9 A;  3OHL A;  1EAK A;  4AUO A;  2WOA A;  3RTS A;  2D1N A;  3L0T A;  1Y93 A;  1CIZ A;  3BA0 A;  3HY9 A;  1JAO A;  3DNG A;  4WZV A;  1XFZ A;  4PKW A;  3E8R A;  2RJP A;  1KUF A;  3LK8 A;  1SU3 A;  1YCM A;  2SRT A;  2USN A;  4H3X A;  2ERP A;  4A7B A;  5I2Z A;  1Q3A A;  2W12 A;  1ZVX A;  1FLS A;  3O2X A;  1GO7 P;  2YB9 A;  1G9K A;  1KUI A;  1ROS A;  1Z3J A;  1D8F A;  1I73 A;  3LUN A;  1BKC A;  1HOV A;  1CGL A;  2W14 A;  4G9L A;  3VTG A;  2OW2 A;  5LAB A;  3HBV P;  2OY4 A;  1HFS A;  4PKU A;  2JNP A;  1SRP A;  4WF6 A;  3LGP A;  2W0D A;  3TVC A;  1ZP5 A;  3G42 A;  1OM8 A;  2OW0 A;  5D1T A;  1J7N A;  3EWJ A;  1D8M A;  1GE6 A;  3V96 B;  2X7M A;  1SLN A;  2OVX A;  3HDA P;  3I7I A;  3GBO A;  2WO9 A;  3AYK A;  3P1V A;  3CKI A;  1G49 A;  3G5C A;  3EDH A;  3O64 A;  4GR8 A;  2CKI A;  1AST A;  2HU6 A;  1PWW A;  1BSW A;  1B8Y A;  1I1I P;  2XS4 A;  3I7G A;  3EHX A;  1KBC A;  2WO8 A;  3UVC A; 
#chains in the Genus database with same CATH topology
 2X3B A;  4PKV A;  2PJT A;  3NX7 A;  1HV5 A;  5BOY A;  4IJO A;  1JIZ A;  4Q1L A;  3WV1 A;  1AYK A;  4JA1 A;  830C A;  2QPJ A;  2MLS A;  1YP1 A;  3LQB A;  3LQ0 A;  2AYK A;  3HY7 A;  4ON1 A;  3HYG A;  4DV8 A;  1OMJ A;  4WKE A;  1JAQ A;  2OZR A;  1G4K A;  1XFU A;  4PKR A;  2OW1 A;  4I35 A;  1CGE A;  1OM6 A;  4H1Q A;  1CXV A;  1WNI A;  2JT6 A;  3EDZ A;  2OVZ A;  1R55 A;  2ERO A;  1ATL A;  1PWV A;  2OXW A;  2DDF A;  1G12 A;  4H49 A;  2CLT A;  4H82 A;  2AIG P;  3B8Z A;  3DWB A;  1D5J A;  2A8H A;  4L19 A;  4H30 A;  1XFY A;  5CZM A;  1ZXC A;  5D2B A;  1GE5 A;  3HBU P;  1HY7 A;  2XS3 A;  1CAQ A;  3DTI A;  1QJJ A;  1SAT A;  3Q2G A;  2DDY A;  1Y8J A;  3LIR A;  2L0R A;  4XM8 A;  1ZS0 A;  3HB2 P;  1L6J A;  1GKC A;  1XUD A;  1OS9 A;  1BQO A;  3MA2 A;  2JSD A;  1HTD A;  4GQL A;  2JT5 A;  1OS2 A;  3LKA A;  3F18 A;  2X3C A;  2MZH A;  1RMZ A;  4L7A A;  1CQR A;  3DL1 A;  2O3E A;  2ERQ A;  3F16 A;  4FXQ A;  2TCL A;  5H8X A;  3LJG A;  1EUB A;  1XUR A;  1KUK A;  4FVL A;  5B5O A;  1RM8 A;  4DPE A;  1R54 A;  1R1I A;  5BOT A;  5I4O A;  2N8R A;  2Y6C A;  1OM7 A;  4AXQ A;  4JPA A;  1C8T A;  1AKL A;  4FU4 A;  1C3I A;  3OHO A;  1K7G A;  1BQQ M;  1Y0V A;  1GO8 P;  1JKY A;  1OZ9 A;  1ZXV A;  1JAP A;  1IAC A;  3N2U A;  3K7N A;  3F17 A;  3F15 A;  4L63 A;  2Z2D A;  2W15 A;  5D3C A;  4IN9 A;  3USN A;  1K7Q A;  2RJQ A;  1I76 A;  4XBH A;  3LJZ A;  3B2Z A;  4L6T A;  1O0T A;  3KME A;  4DF9 A;  2POJ A;  3L0V A;  4H84 A;  1CGF A;  2OI0 A;  4FXY P;  5I0L A;  4PKT A;  3Q2H A;  5D1S A;  3WV3 A;  1A86 A;  1QJI A;  1JAN A;  3VI1 A;  1UMS A;  2FV5 A;  3KMC A;  4WKI A;  4J4M A;  1JK3 A;  1CK7 A;  2YIG A;  3ZUK A;  1TVI A;  1EB6 A;  3EDG A;  1IAE A;  1KUG A;  3AYU A;  3F1A A;  3KEJ A;  3EHY A;  5I12 A;  3RTT A;  2W13 A;  2D1O A;  3DPF A;  1XFX A;  3ZXH A;  1JJ9 A;  3KEC A;  3SHI A;  1D7X A;  2KRJ A;  1ND1 A;  5D7W A;  5BPA A;  1SMP A;  3HDB A;  5I3M A;  1QIB A;  4R3V A;  1UTZ A;  1BUV M;  2Y6D A;  3K7L A;  5L7F A;  1USN A;  3KHI A;  1G05 A;  2K2G A;  1H71 P;  2OXU A;  1K7I A;  4PKQ A;  5CUH A;  1DMT A;  1IAG A;  3KEK A;  4XM7 A;  3EDI A;  1XFV A;  2J0T A;  3ELM A;  4H2E A;  1PWQ A;  1GKD A;  4IUW A;  4HX3 A;  1QUA A;  3U1R A;  3B92 A;  1JH1 A;  1GE7 A;  3LIL A;  456C A;  2I47 A;  1XAX A;  4GWM A;  2YUF A;  3F19 A;  1MNC A;  4AYK A;  4I03 A;  4A3W A;  1B3D A;  5L79 A;  1R1H A;  4GF1 A;  3KRY A;  3TT4 A;  1XFW A;  1MMB A;  1FM1 A;  3LUM A;  4XM6 A;  1IAB A;  2DW0 A;  3LE9 A;  2E3X A;  1C7K A;  2JIH A;  2OW9 A;  1IAA A;  966C A;  1BKC I;  2MZI A;  2K9C A;  3KWV C;  3N2V A;  1MMP A;  4JIJ A;  1MMQ A;  4JP4 A;  1S4B P;  4PKS A;  2MZE A;  5CXA A;  4G0D A;  3TSK A;  1IAD A;  1ZTQ A;  1MMR A;  4H76 A;  1UTT A;  5JMY A;  1YQY A;  4ZR5 A;  2V4B A;  1KUH A;  2J83 A;  2OY2 A;  1GXD A;  2X3A A;  5B5P A;  4ILW D;  4DD8 A;  4HMA A;  1AF0 A;  1UMT A;  1QIC A;  4QKZ A;  1HFC A;  1R1J A;  3LJT A;  1OO9 A;  2E2D A;  1O0Q A;  1YOU A;  4XCT A;  2DW2 A;  4WK7 A;  3DTK A;  5I43 A;  1BUD A;  1JIW P;  4GR3 A;  3TS4 A;  1BKC E;  1UEA A;  2OXZ A;  3AIG A;  3LEA A;  1SLM A;  2MLR A;  2O36 A;  1A85 A;  3LIK A;  3ZVS A;  3WV2 A;  1KAP P;  1FBL A;  4AIG A;  1BM6 A;  3P24 A;  1PWP A;  3LMC A;  1DTH A;  1BZS A;  3DPE A;  4GR0 A;  1BIW A;  1QIA A;  1PWU A;  5D1U A;  2DW1 A;  4GWN A;  3DSL A;  1XUC A;  4GUY A;  4JQG A;  4EFS A;  4CTH A;  2FV9 A;  3OHL A;  1EAK A;  4AUO A;  2WOA A;  3RTS A;  2D1N A;  3L0T A;  1Y93 A;  1CIZ A;  3BA0 A;  3HY9 A;  1JAO A;  3DNG A;  4WZV A;  1XFZ A;  4PKW A;  3E8R A;  2RJP A;  1KUF A;  3LK8 A;  1SU3 A;  1YCM A;  2SRT A;  2USN A;  4H3X A;  2ERP A;  4A7B A;  5I2Z A;  1Q3A A;  2W12 A;  1ZVX A;  1FLS A;  3O2X A;  1GO7 P;  2YB9 A;  1G9K A;  1KUI A;  1ROS A;  1Z3J A;  1D8F A;  1I73 A;  3LUN A;  1BKC A;  1HOV A;  1CGL A;  2W14 A;  4G9L A;  3VTG A;  2OW2 A;  5LAB A;  3DTE A;  3HBV P;  2OY4 A;  1HFS A;  4PKU A;  2JNP A;  1SRP A;  4WF6 A;  3LGP A;  2W0D A;  3TVC A;  1ZP5 A;  3G42 A;  1OM8 A;  2OW0 A;  5D1T A;  1J7N A;  3EWJ A;  1D8M A;  1GE6 A;  3V96 B;  2X7M A;  1SLN A;  2OVX A;  3HDA P;  3I7I A;  3GBO A;  2WO9 A;  3AYK A;  3P1V A;  3CKI A;  1G49 A;  3G5C A;  3EDH A;  3O64 A;  4GR8 A;  2CKI A;  1AST A;  1XM5 A;  2HU6 A;  1PWW A;  1BSW A;  1B8Y A;  1I1I P;  2XS4 A;  3I7G A;  3EHX A;  1KBC A;  2WO8 A;  3UVC A; 
#chains in the Genus database with same CATH homology
 2X3B A;  4PKV A;  2PJT A;  3NX7 A;  1HV5 A;  5BOY A;  4IJO A;  1JIZ A;  4Q1L A;  3WV1 A;  1AYK A;  4JA1 A;  830C A;  2QPJ A;  2MLS A;  1YP1 A;  3LQB A;  3LQ0 A;  2AYK A;  3HY7 A;  4ON1 A;  3HYG A;  4DV8 A;  1OMJ A;  4WKE A;  1JAQ A;  2OZR A;  1G4K A;  1XFU A;  4PKR A;  2OW1 A;  4I35 A;  1CGE A;  1OM6 A;  4H1Q A;  1CXV A;  1WNI A;  2JT6 A;  3EDZ A;  2OVZ A;  1R55 A;  2ERO A;  1ATL A;  1PWV A;  2OXW A;  2DDF A;  1G12 A;  4H49 A;  2CLT A;  4H82 A;  2AIG P;  3B8Z A;  3DWB A;  1D5J A;  2A8H A;  4L19 A;  4H30 A;  1XFY A;  5CZM A;  1ZXC A;  5D2B A;  1GE5 A;  3HBU P;  1HY7 A;  2XS3 A;  1CAQ A;  3DTI A;  1QJJ A;  1SAT A;  3Q2G A;  2DDY A;  1Y8J A;  3LIR A;  2L0R A;  4XM8 A;  1ZS0 A;  3HB2 P;  1L6J A;  1GKC A;  1XUD A;  1OS9 A;  1BQO A;  3MA2 A;  2JSD A;  1HTD A;  4GQL A;  2JT5 A;  1OS2 A;  3LKA A;  3F18 A;  2X3C A;  2MZH A;  1RMZ A;  4L7A A;  1CQR A;  3DL1 A;  2O3E A;  2ERQ A;  3F16 A;  4FXQ A;  2TCL A;  5H8X A;  3LJG A;  1EUB A;  1XUR A;  1KUK A;  4FVL A;  5B5O A;  1RM8 A;  4DPE A;  1R54 A;  1R1I A;  5BOT A;  5I4O A;  2N8R A;  2Y6C A;  1OM7 A;  4AXQ A;  4JPA A;  1C8T A;  1AKL A;  4FU4 A;  1C3I A;  3OHO A;  1K7G A;  1BQQ M;  1Y0V A;  1GO8 P;  1JKY A;  1ZXV A;  1JAP A;  1IAC A;  3N2U A;  3K7N A;  3F17 A;  3F15 A;  4L63 A;  2Z2D A;  2W15 A;  5D3C A;  4IN9 A;  3USN A;  1K7Q A;  2RJQ A;  1I76 A;  4XBH A;  3LJZ A;  3B2Z A;  4L6T A;  1O0T A;  3KME A;  4DF9 A;  2POJ A;  3L0V A;  4H84 A;  1CGF A;  2OI0 A;  4FXY P;  5I0L A;  4PKT A;  3Q2H A;  5D1S A;  3WV3 A;  1A86 A;  1QJI A;  1JAN A;  3VI1 A;  1UMS A;  2FV5 A;  3KMC A;  4WKI A;  4J4M A;  1JK3 A;  1CK7 A;  2YIG A;  3ZUK A;  1EB6 A;  3EDG A;  1IAE A;  1KUG A;  3AYU A;  3F1A A;  3KEJ A;  3EHY A;  5I12 A;  3RTT A;  2W13 A;  2D1O A;  3DPF A;  1XFX A;  3ZXH A;  1JJ9 A;  3KEC A;  3SHI A;  1D7X A;  2KRJ A;  1ND1 A;  5D7W A;  5BPA A;  1SMP A;  3HDB A;  5I3M A;  1QIB A;  4R3V A;  1UTZ A;  1BUV M;  2Y6D A;  3K7L A;  5L7F A;  1USN A;  3KHI A;  1G05 A;  2K2G A;  1H71 P;  2OXU A;  1K7I A;  4PKQ A;  5CUH A;  1DMT A;  1IAG A;  3KEK A;  4XM7 A;  3EDI A;  1XFV A;  2J0T A;  3ELM A;  4H2E A;  1PWQ A;  1GKD A;  4IUW A;  4HX3 A;  1QUA A;  3U1R A;  3B92 A;  1JH1 A;  1GE7 A;  3LIL A;  456C A;  2I47 A;  4GWM A;  2YUF A;  3F19 A;  1MNC A;  4AYK A;  4I03 A;  4A3W A;  1B3D A;  5L79 A;  1R1H A;  4GF1 A;  3KRY A;  3TT4 A;  1XFW A;  1MMB A;  1FM1 A;  3LUM A;  4XM6 A;  1IAB A;  2DW0 A;  3LE9 A;  2E3X A;  1C7K A;  2JIH A;  2OW9 A;  1IAA A;  966C A;  1BKC I;  2MZI A;  2K9C A;  3KWV C;  3N2V A;  1MMP A;  4JIJ A;  1MMQ A;  4JP4 A;  1S4B P;  4PKS A;  2MZE A;  5CXA A;  4G0D A;  3TSK A;  1IAD A;  1ZTQ A;  1MMR A;  4H76 A;  1UTT A;  5JMY A;  1YQY A;  4ZR5 A;  2V4B A;  1KUH A;  2J83 A;  2OY2 A;  1GXD A;  2X3A A;  5B5P A;  4ILW D;  4DD8 A;  4HMA A;  1AF0 A;  1UMT A;  1QIC A;  4QKZ A;  1HFC A;  1R1J A;  3LJT A;  1OO9 A;  2E2D A;  1O0Q A;  1YOU A;  4XCT A;  2DW2 A;  4WK7 A;  3DTK A;  5I43 A;  1BUD A;  1JIW P;  4GR3 A;  3TS4 A;  1BKC E;  1UEA A;  2OXZ A;  3AIG A;  3LEA A;  1SLM A;  2MLR A;  2O36 A;  1A85 A;  3LIK A;  3ZVS A;  3WV2 A;  1KAP P;  1FBL A;  4AIG A;  1BM6 A;  3P24 A;  1PWP A;  3LMC A;  1DTH A;  1BZS A;  3DPE A;  4GR0 A;  1BIW A;  1QIA A;  1PWU A;  5D1U A;  2DW1 A;  4GWN A;  3DSL A;  1XUC A;  4GUY A;  4JQG A;  4EFS A;  4CTH A;  2FV9 A;  3OHL A;  1EAK A;  4AUO A;  2WOA A;  3RTS A;  2D1N A;  3L0T A;  1Y93 A;  1CIZ A;  3BA0 A;  3HY9 A;  1JAO A;  3DNG A;  4WZV A;  1XFZ A;  4PKW A;  3E8R A;  2RJP A;  1KUF A;  3LK8 A;  1SU3 A;  1YCM A;  2SRT A;  2USN A;  4H3X A;  2ERP A;  4A7B A;  5I2Z A;  1Q3A A;  2W12 A;  1ZVX A;  1FLS A;  3O2X A;  1GO7 P;  2YB9 A;  1G9K A;  1KUI A;  1ROS A;  1Z3J A;  1D8F A;  1I73 A;  3LUN A;  1BKC A;  1HOV A;  1CGL A;  2W14 A;  4G9L A;  3VTG A;  2OW2 A;  5LAB A;  3DTE A;  3HBV P;  2OY4 A;  1HFS A;  4PKU A;  2JNP A;  1SRP A;  4WF6 A;  3LGP A;  2W0D A;  3TVC A;  1ZP5 A;  3G42 A;  1OM8 A;  2OW0 A;  5D1T A;  1J7N A;  3EWJ A;  1D8M A;  1GE6 A;  3V96 B;  2X7M A;  1SLN A;  2OVX A;  3HDA P;  3I7I A;  3GBO A;  2WO9 A;  3AYK A;  3P1V A;  3CKI A;  1G49 A;  3G5C A;  3EDH A;  3O64 A;  4GR8 A;  2CKI A;  1AST A;  2HU6 A;  1PWW A;  1BSW A;  1B8Y A;  1I1I P;  2XS4 A;  3I7G A;  3EHX A;  1KBC A;  2WO8 A;  3UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...