9ESTA

Structural study of porcine pancreatic elastase complexed with 7-amino-3-(2-bromoethoxy)-4-chloroisocoumarin as a nonreactivatable doubly covalent enzyme-inhibitor complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of porcine pancreatic elastase complexed with 7-amino-3-(2-bromoethoxy)-4-chloroisocoumarin as a nonreactivatable doubly covalent enzyme-inhibitor complex.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1991-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 9estA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 9estA01
1W8BH 4YZUA 2ZDLA 4IN1A 3RC6A 3UOUA 1GCTC 5GPIB 1T8LA 1A1RA 1Z8GA 3C27B 2QCYA 3GISB 1TWXB 1QL7A 3AAUA 1V2UT 5A0BA 1TGCA 5FBEA 1DWCH 4O3TA 2CV3A 2AERH 3U1IB 1MU6B 4U2WA 4WMEA 1DWDH 1SG8B 1C2HA 2FOCA 3E91A 1C5SA 3VGCB 1WAYB 4Y7AA 1HNEE 1SVPA 1XVOA 1PQAA 1ZRKA 2PFEA 2UWPA 1SLUB 3U8RH 1NS3A 4XDEA 5TCAA 1GBFA 3LOXA 4WWYA 3RP2A 2BQWB 3SO3A 2BLOA 1YBWA 3A86A 3RXEA 1O2YA 3EQ0H 2ODPA 3KNXA 2J95A 4X1PU 1Q3XA 1AO5A 5I25A 1ELFA 4NWKA 5GIBA 1ANBA 2FP7B 4FUHA 4KTSA 4GLYA 3GY3A 1GVKB 1GBTA 2PTCE 3PYHA 3KCGH 2VIQA 1TPSA 3LH3A 1C5OH 3L33A 4YO9A 4NGAH 1YLDA 4BAHB 3RXLA 2ASUB 3GDUA 1V2OT 5EQRA 5LPRA 2VU8E 4OS2A 4B2AA 2JETC 2JKHA 3V0XA 1OWEA 3CS7A 1SL3A 3EA8A 4ZXYH 1C4Y2 4MPVA 1C1QA 1HDTH 1SGFA 5GDSH 3QUMP 1MMJN 4NCYA 3SGAE 1NFXA 1LMWB 2B9LA 4CH8B 2WPKS 2Z9IA 1BRUP 2R3YA 1WTHD 1QGFA 5JBTA 1O5DH 4Y8XA 4E05H 1YP9A 2KAIB 5AFZH 3PWBA 1S84A 2BLQA 1TNKA 1O2UA 7LPRA 2LNCA 1AZZA 1O0DH 3U8OH 1NFYA 3FP7E 1QBVH 1O3NA 1BTPA 3GDSA 2P3FH 1GJBB 1C1VH 3KHVA 1DICA 2C8ZB 5DGJA 3D65E 1JMOH 1Y3UA 3MNXA 3A88A 1G3DA 1AI8H 2J94A 1F0UA 1NRSH 1TMBH 4X1SU 2QY0B 4UFDH 2ALPA 2JETB 1IQMA 1XKAC 3ZV9A 3AW0A 2Y5GA 3GCHB 1Z6JH 1P3CA 3PMBB 1GL1A 3TGKE 2Y5HA 1D6WA 1V2WT 1XUGA 4ZHAA 3ZVCA 2R0KA 2AMDA 3KGPA 3B9FH 3GCHC 4MPWA 3O8BA 1ZPBA 2PUQH 2ZTYA 1O5BB 1V2RT 2GX4A 5C5OA 4A7IB 2NU2E 1SGDE 3NPSA 5C3NA 4MVNA 2BQ7B 4DGJA 2ZZUH 1NY22 4I32A 1OP8A 1YCPH 3TJNA 1ZHPA 2PGQB 3MWIU 2M5TA 1C1WH 2GTBA 1GGDB 1VITF 1QY6A 1AQ7A 1JOUB 1GBLA 1VR1H 5IYTA 5C67A 5CHAC 1K22H 1QBOA 3LGVA 4ZKOU 4FUBA 5A09A 4B1TA 3PB1E 3PMJA 4JK6A 4O9VA 4JMYA 2BLVA 5EXMA 1DSTA 1K1IA 2B5TB 4CHAB 5JB8S 1TOMH 2UWLA 3BF6H 1JRSA 1V2QT 1ETSH 3P17H 1HJ8A 1AB9B 4AYVB 3GY6A 5EG4A 3RC4A 3RLWH 1L4DA 2Y7XA 3OX7U 1MD7A 2EI6A 2VIWA 5L6NH 1KLIH 1NTPA 1P2KA 1VGCC 2BVXH 1A5HA 1TABE 1LDTT 2TPIZ 1AVGH 3AW1A 1NO9H 4TWYA 2QXJA 4O3UA 3ZVDA 4B2BA 1E0FD 3PWCA 3SJ9A 2QAAA 4PROA 1JRTA 3RXAA 5JDUB 1G3EA 1J8AA 2SGAA 1B0FA 1GHBF 1O3PB 2RA3A 2VNTA 4UEHH 2HPPH 2QC2A 1HB0B 1TALA 3U9AH 1O2RA 4E7NA 1OPHB 4CRBA 2FOMB 5T6DA 3F6UH 4GAWA 3RMNH 1EZUC 5K0HA 1TPOA 2DE8A 4JZEH 1GMDF 1FQ3A 4K69A 4XBCA 1Z6EA 1A4WH 2J2UA 2VVVA 2XYAA 3VB7A 2R3UA 3DT0H 2OC0A 3P8GA 1C5VA 1LHFH 1K1JA 3P92A 2P94A 4RKJB 1TONA 2CHAC 2ANMH 1GJDB 2W26A 2PKSB 3BIUH 1QRXA 1BMAA 1TNGA 2FS9A 2FI4E 1BIOA 1XX9A 4OS6A 2ZHQH 1IQFA 2VGCC 2QF0A 3AASA 2PKAA 4K2YA 1CVWH 1GPZA 4XBBA 1TLDA 1LO6A 2UUKB 1ZGVA 1N6XA 1VJ9U 3MYWA 2J4IA 1ZOMA 4CBOA 3TPIZ 2BXUH 1C1SA 3NZIA 1W7GH 1NZQH 4X2YA 2ZDKA 4H4FA 3TK5A 4ZROA 2OC8A 1LQEA 1HJAC 1P2OA 2ZDNA 4BTTB 4IN2A 1O2JA 1UTNA 2F9PA 2A2XH 1UTKA 2AIQA 1FAXA 4A1VA 5DP9A 2W7SA 3UNRA 1O2LA 3ESTA 1A5GH 3SHCH 3IWMA 3M61U 1LHGH 3TIUA 3ZVFA 1GBBA 1SGEE 2NU3E 1YPHE 2HNTE 2ZF0H 2XTTB 1EQ9A 1O3EA 4INLA 1NROH 2FYRA 1SFQB 2SGDE 4D9RA 1MZDA 2BMGB 2UUYA 1BT7A 1DT2A 1MTNB 1AB9C 1EP6A 1SHYA 2FIRH 1SB1H 1C9PA 4NA7A 1MAXA 1MKXK 1GHXH 3LC3A 1ETRH 1HV7A 1O3KA 4GCHF 5L30H 1BQYA 3M5NA 3U8TH 1OP0A 1Q2WA 1IQKA 3MI4A 1GL0E 3M7TA 1L2EA 2A31A 1O3LA 4Y0YE 1O2QA 1ZSKA 2TIOA 3P95A 3B8JA 1QR3E 2Z3DA 1GI7B 2ZCLP 2FODA 2UUFB 3WY8A 5EW1H 2HGTH 5DP8A 1HLTH 3A80A 3FAOA 3M5MA 2AIPA 2W3KA 1A2CH 3GY5A 3SV2H 4FU8A 1TGTA 3TVJB 2Y82A 3Q3YA 1Z8IB 2WPHS 4AYYB 4X6OA 2SNVA 1QA7A 4LK4A 3VB6A 2F9NA 2C8YB 3NUMA 1P03A 1EUFA 1AKSA 1O3JA 1LPZB 4Z0KA 4FUDA 1GJCB 1FV9A 1UTOA 4AFQA 2KAIA 2A7CA 1OWJA 2ZPQA 1XUIA 3R0FA 2ZCHP 1TNIA 2P8OB 2BOHB 4X8TH 1WU1A 2SGQE 2ZI2H 2BX3A 1OSSA 4U01A 2BY5X 2R9PA 3K6ZA 3DA9B 2ZHDA 3TH2H 1KDQA 5GCHF 1QL9A 2A5KA 2D26C 1UVOA 2AGGX 3SJIA 2ZGJA 1G9IE 2ZECA 4TY6A 4WF8A 2UWOA 2XBVA 2BD5A 1TYNA 3MH4A 1C5MD 2BQ6B 4I7YH 1GDNA 4X0WU 3Q3KA 3LGUA 3MMGA 1PYTD 1S6HA 3MO9A 3RXKA 1FN8A 2BZ6H 2D1JA 3MH6A 1FDPA 1XUFA 2ANYA 4UDWH 5IDKA 1RTLA 1XUKA 3RU4E 3RXPA 1HUTH 1P0SH 4MTBA 4KKDA 1SMFE 2BZAA 4NIXA 4AG2A 4DIIH 4ZKNU 1WYKA 3UUZA 1O39A 4WXIA 1S81A 1GJAB 1C5NH 1NFWA 2Y80A 3HK3B 1K2I1 2ZP0H 1BTHH 4FUIA 6CHAB 4DIHH 1IQIA 1FPHH 3TK6A 3ZZAA 5HYOA 1O2TA 2ZKSA 1FZZA 1PPCE 2G52A 4M7GA 6CHAC 3FZZA 2PGBB 1IHSH 1QBNA 2Y6TA 3NCLA 2G4UA 1ZTKA 1WTGH 1HJAB 1LCYA 1P05A 1K1MA 2OINA 2H5DA 1CHOF 4FVBA 4CRDA 1HAZB 1C5UA 4ZMAH 4I8KA 1FPCH 3T29A 2AH4X 1B5GH 1SFIA 2XNIA 1GMHG 4CHAC 1C1MA 2BD3A 1CO7E 1BRCE 3QTVH 4AGJA 4BAKB 2F9VA 2PTNA 3F9HA 1ZSLA 3PO1C 1J17T 3O8CA 3H7TA 4X1RU 5C20A 1LTOA 1MD8A 3EGKH 1ZMNA 5LGOA 1QL8A 2PW8H 5G4BA 3L3TA 2Z9JA 4ABDA 3ATMA 1BA8B 1TNLA 5GJ4B 2J9NA 1K1NA 1G2MA 2Y7ZA 1FMGA 2IOTA 2XXLA 3OY6U 4HI3A 4F49A 4ABBA 2FOFA 2XWAA 4GCHG 3T26A 3A8BA 1EB2A 1WUNH 1OP2A 3LKWA 1O33A 2P3UB 3OYPA 2J38A 1KXEA 3S69A 5HM2A 1OWHA 1EAWA 1V2VT 2DE9A 2QYIA 3T25A 2R2WU 3ZZ9A 1YPEH 1H8IH 2VWNA 2QXIA 2GV7A 3F68H 3SJOA 3BG4B 1O2MA 1ZZZA 2FO9A 4MG3A 5A8YA 1AUJA 2PKAB 3GDVA 3T5FH 4TWWA 3F9GA 5DO4H 1T8NA 2XC4A 2Z94A 2O9QA 1UHBB 4K1SA 2FX4A 2K1QA 1YF4A 5GCHG 2NWNA 2ZHEH 2V35A 2STAE 4BAOB 2FESH 2GP9B 3SJ8A 4H42U 1SHHB 1F0TA 4A5TS 3U1JB 3HKJB 1C4U2 1P8VC 1GJ4H 2AYWA 4ISLA 2FM2A 4IC6A 1AY6H 1QQUA 1W3CA 5F03A 1C2LA 3KL6A 2FLBH 3LGTA 1FY4A 1P01A 2ALVA 1MKXH 1BCUH 1QJ7B 1DXPA 4NA8A 1LPKB 1O2KA 1O3OA 1AFEH 5AHGH 1DXWA 1C2DA 2LPRA 2V3OH 3RXVA 3ZZ6A 5T6GA 2THFB 2FOAA 2TGTA 4YTAA 1L4ZA 3MH5A 3SU4A 2ILNA 2V3HH 3ZYEA 4WY3A 5C2ZA 4OS1A 3GYLB 4FUGA 4ZAEA 2ZU4A 2OUAA 2ZU1A 3BTHE 1D3TB 1YCPM 1PQ7A 1E35B 1LHDH 4Y6DA 1Y8TA 1UTLM 1O5EH 2BD8A 1P9SA 5DPAA 1MQ6A 1ANEA 1O2OA 1PPGE 1KSNA 2OC1A 1H9LB 1K28D 4FXGH 1O2NA 4I33A 2PUXB 4ABHA 2ZCKP 1ZSJA 1L1NA 4MDSA 4MNYA 3P6ZB 4ZH8A 3LU9B 1AIXH 2XWBI 3URCA 2G51A 1UTJA 1BMMH 3G01A 1TBZH 2BHGA 3UOPA 1HYLA 1SGNE 1Z1IA 3D62A 4NSVA 2YNAA 1LHEH 1NM6A 3RM2H 2BD9A 4UFGH 3TJOA 5DP6A 4JCNA 3E0NB 3RXGA 1V2PT 1WQVH 1IQJA 4LZ1H 1L0ZA 1AUTC 2I6SA 4X6MA 2ANWA 3A7TA 1P12E 1HAHH 2D2DA 3MH7A 1RXPA 3K6YA 5A2MH 2HALA 2QXGA 3UWJH 1C5QA 5F8ZA 4BOHA 1AMHA 4A1TA 1GHAF 1V6DA 2A32A 3QX5H 1Y3WA 3E3TA 5E0GA 3RXCA 1P02A 3ZZDA 3BTGE 1THSH 1GHYH 5DKMA 4ISOA 2XBWA 1ANDA 1HXFH 1CA8B 1ANCA 1G3BA 4ZKRU 3UPEA 4IMZA 2BDGA 1P09A 4AB9A 4BTUB 5AFYH 1GI5A 1GCDA 1OYTH 4OS5A 2C8XB 2G00A 1A0HB 1TA2A 2SFAA 2WINI 2CJIA 2HVXA 1HAOH 1CA0B 1TIOA 5B6OA 3QO6A 1ARCA 2Z7FE 1FI8A 3BTEE 1TRYA 4FVDA 1U6QA 1MUEB 1XUJA 1JIMA 3SU6A 1PFXC 1DFPA 1QTFA 1ZHMA 1J15A 1O34A 2ZFRH 2ZFSA 3CS0A 4I8JA 4X2WA 4D76A 2A7HA 1O2PA 3CENA 1WQSA 2BOKA 1NU9A 1P57B 1XXFA 3FP6E 2ESTE 3A7WA 1EJMA 1C2GA 1LVBA 5H4IB 2EEKA 2GGVB 3Q00A 4DVAU 1G3CA 4IC5A 3RMOH 3MNCA 2VB0A 1D6RA 1BJVA 5C1UA 3ZVGA 3SJKA 2AGIX 2H2ZA 1AKSB 1GHWH 1XVMA 2GZ7A 1KXDA 9LPRA 3ODDA 2PHBA 1GG6C 3T62A 2P8OC 5E0HA 2BTCE 1A3EH 3BIVH 4JYTA 2AGEX 4DCDA 3URDA 3ATWA 1BTZA 4FUCA 4X6NA 1SGTA 4YESB 1BUIA 1C4V2 3HGNA 4TYDA 1IAUA 2ZEBA 3S7HB 3A8DA 3EYDA 1TX6A 2WPIS 1TGBA 1TNHA 4HGCA 4KGAA 1NU7B 4BAQB 1EAIA 2OLGA 1MKWH 2XC0A 1G36A 1GJ5H 1BRBE 3CP7A 1HRTH 8GCHF 4K8YA 2A45B 3RLYH 5DG6A 1SQTA 3MU0A 2AS9A 4CBNA 4AN7A 2FMJA 4Y71A 1ABJH 4Y8YA 2ZDAH 1GBHA 2F83A 1GI6A 2WYGA 3ZZ8A 1AWHB 4WXVA 2VIDA 3F9FA 1BMNH 1BBRH 5CMXH 1ELAA 2O8MA 3GICB 1UJ1A 4BAMB 1SLXB 2Z9LA 1E38B 1O38A 1K9OE 4I8HA 3GCNA 5EPYA 3S9CA 1TRNA 8GCHG 1THPB 1GI1A 1C2FA 1VZQH 3FP8E 2GCHG 1H9HE 5ESBA 1HAVB 1EPTB 1GHAG 1S0QA 4K1EA 1FIZA 1KXBA 1G37A 1NPMA 3TNSA 7KMEH 1C5TA 2VVCA 3DHKH 1JIRA 1KLTA 4Q2KA 1MKWK 1W0ZU 4YT6H 4CREA 5EXNA 5JBBS 3SOSA 2HOBA 1BOQA 1RD3B 1W0YH 1RFNA 2BX4A 4SGAE 2RCEA 1PYTC 1LVOA 5LH8A 4F4OC 2WV5A 1DWEH 3DFLA 2GDDA 4BXWA 1FXYA 1A46H 3RXFA 4GPGA 4DY7B 3EA7A 1GJ6A 5HXFA 1V2ST 3JZ1B 1Y3VA 4D7GA 4ABIA 3MU1A 3S0NA 1OXGA 2CN0H 1EZQA 3E0PB 1LVYA 3A8CA 2F91A 1T4VH 1FUJA 3BTWE 1OYQA 1FY3A 1ELEE 3TH4H 2CF8H 1NFUA 1QJ6B 1TMUH 1H8DH 1NRRH 1W7XH 1T7CA 2IJOB 1C9TA 4VGCC 1AFQC 2OBOA 3BTDE 8LPRA 2W5EA 3ITIA 2ZQ1A 1RIWC 2FTMA 3I29A 1QQ4A 4ESTE 4CRFA 4OGXA 1TBQH 1B0EA 1CA0C 1O36A 4A1XA 4IGDA 4K5ZA 1GCTB 9ESTA 2XBYA 1DOJA 3BTME 1UK4A 4UD9H 3M3VA 1HAPH 1MU8B 1AVWA 3P8NA 1NN6A 2IN2A 1AD8H 4A6LA 1AHTH 2QXHA 1CBWB 1SSXA 1UTQA 4X8VH 2BY6X 2EI8A 4MQAA 1QRZA 1GDUA 3SV9A 2BDIA 3RXTA 1O32A 1JBUH 4ASHA 1XUHA 4UFEH 1PPBH 3KIDU 1D3DB 4CRGA 4BANB 3V12A 2Z3EA 1YKTA 1TFXA 5A0AE 1EJNA 1ZR0A 2FOBA 1C5PA 5GXPA 2J34A 1LHCH 1UTMA 3SV7A 1UCYK 3M5LA 1S82A 3L6PA 1CGJE 2CHAB 1OWDA 4DURA 4AORA 1P2QA 3T27A 1RIWB 1HGTH 4DOQA 4X6PA 3E16B 1P2JA 2EI7A 3OSYA 3SU1A 2SGEE 3SUDA 3PLBA 3HGPA 4WMFA 1GVZA 3S9BA 1BTXA 1P2IA 2PLXA 2P3TB 3MU4A 1HIAB 1ELTA 4MLFB 3RU4D 3SW2B 7GCHG 3ZZ4A 1HAYB 3MFJA 3QDZB 1TAWA 3H7OA 1ESAA 1H9IE 2OP9A 1N8OC 2P59A 3P8OA 4Y7BA 5HGGA 3TNTA 4JZ1A 3RXOA 2UUJB 3MHWU 1J9CH 4X2VA 2ZTZA 3SNDA 1EB1H 1SI5H 1Y5AT 2A7JA 1UCYE 1F7ZA 1GMCF 4J1YA 1Y59T 4ZUHA 2BD4A 4YOGA 2G81E 1DPOA 1Y3YA 4IS5A 4ISHH 2R0LA 2BDYA 2Y81A 1O3CA 2OTVA 3PO1B 1W10U 4MPUA 3TGIE 1GDQA 3SUGA 5DK1A 1UCYH 1FIWA 1Y5UT 1TPAE 1E34B 3UR9A 1F5RA 3SV6A 1BZXE 4JZFH 1SBWA 2OC7A 5EQQA 2VWLA 3ZZ3A 4ZHLU 2OQ5A 3I77A 3VPKA 2FWWA 2HPQH 1H4WA 1ESBA 2VH6A 4R8TB 3RXHA 6GCHG 1TRMA 1GGDC 1HXEH 5FPYA 3STIA 3RXSA 4NZLA 2C8WB 3C1KA 1GI4A 1TNJA 1NC6A 2W7UA 3TH3H 4QT8C 4Q7ZA 4ISIH 4IBLH 2FPZA 2ZWLH 5CE1A 2WPMS 3RXDA 3V13A 1BITA 1SQOA 3GY4A 4YOJA 1GJ7B 1EATA 5EW2H 1GHZA 2B7DH 1ZJKA 2BXTH 1UVUH 1HAXB 3K9XB 1XMNB 4HZHA 1BDAA 1C5ZB 2V6NA 4OS4A 3SQHE 4Q80A 5LPEA 3BEUA 4KP0A 5F8TA 1IHTH 4RKOB 1DITH 2Z6BD 1K1LA 4ABEA 1DY9A 3MO6A 3V7TA 1CGHA 1O3AA 5BPEA 2STBE 1EPTA 4YOIA 3RMLH 4FUJA 1S83A 3LIWA 2VWMA 1RTFB 4B74A 2Y5FA 1EASA 3OY5U 1O2HA 1CT0E 1W12U 3NK8A 2RA0A 5FX6A 3O8RA 4ABGA 5JBCS 4VGCB 4AFSA 3D23A 1QIXB 4AG1A 4AX9H 1TX8A 4DG4A 2VIOA 3SGQE 1HJ9A 1KYNA 1PQ5A 1W11U 3KQDA 3UQOA 1SGFG 1CBWC 3HPTB 3Q76A 4WJG2 4MNWA 1YCPK 2BM2A 2HRVA 5EU8A 1V2MT 1PPHE 2AFQB 4FU9A 1ID5H 3ZYDA 1SR5C 1VITG 1QCPA 5FCRA 1CSOE 2BB4A 1LPGB 1O3BA 2HWLB 2ZFFH 1UVPA 2WPLS 3M3SA 1TGSZ 4KTUA 4O03A 1VCQA 5JB9S 2ZGBH 1BTWA 2D8WA 1GHVH 2BD2A 3ZVEA 3S9AA 2A0QB 3A82A 2AMQA 1TE0A 1GBMA 1CT2E 2BDAA 3UNSA 4JZDH 3E1XB 2WYJA 3E6PH 3RXRA 6LPRA 2QIQA 1C2JA 3LJOA 3ATLA 2WUBA 4AZ2B 3KQBA 3PMHB 1KXCA 3FFGA 1BJUA 2QA9E 1ZPZA 5EXLA 1HAGE 2JH5D 2PSXA 4ISNA 4WVPE 4HFPB 1SLWB 1YPJH 1GBJA 2XC5A 1MBMA 4TPIZ 2QF3A 1OX1A 1ZHRA 4ABJA 1EPTC 1MTVA 2GVFA 3E8LA 3SUEA 4CRCA 1DDJA 1N6YA 1KDQB 1DANH 2ODYB 2SNWA 1ELDE 2ZO3H 1D3PB 3FVFB 4B73A 3LGWA 3A7YA 2CF9H 1KLJH 2TBSA 3SGBE 4Y8ZA 7GCHF 1O2WA 1P10A 1W14U 1YGCH 2GDEH 2ZU5A 3KN2A 1AVXA 2P16A 1VCWA 3PTBA 3QGNB 3RMMH 1TMTH 2P93A 3LGIA 3RXJA 4LZ4B 2GD4B 1ORFA 5FPSA 4KTCA 4FUFA 1MH0A 1QURH 2ZNKH 1QB6A 2ZHFH 5DJ7A 2FOHA 1GMDG 1V2JT 1GI3A 1N1LA 5HMAA 8KME2 2ZU2A 4B2CA 4TY7A 1P2MA 2R2MB 3A87A 1GBIA 4YLUA 3SNCA 3MU5A 2A4OA 2FYQA 2ZQ2A 4IMQA 3SORA 2C3SA 2FI3E 2DUCA 4DT7B 1P2NA 1EAXA 4LXBH 5A0CA 1BHXF 1PPZA 3D49H 4A92A 4OGYA 3FZDA 3GCTF 1DLKB 4Y10E 1VJAU 1SOTA 1G32B 1CQQA 1NESE 4ABFA 2W3IA 1KIGH 2CGAA 1P06A 2PSYA 1C2MA 4NIWA 3E90B 3AAVA 1O2XA 1MBQA 3GOVB 1DWBH 2FZZA 2QV1A 4CRAA 1A3BH 2WUCA 3IITA 1OS8A 5JPMH 1K1OA 2VIVA 1O31A 3BEIB 2QGRA 5TCCA 5F8XA 1T4UH 1GI2A 5AVDA 3SUFA 2H9HA 2XCFA 1EXFA 2WPJS 1SGCA 1IQGA 1ACBE 2ZA5A 3AVZA 5DP4A 5E2PA 3RXBA 3A83A 1SGRE 1Z1JA 2TGAA 4WMDA 5A8ZA 4IW4E 3RXMA 3IG6B 1MQ5A 5J4SA 3PROA 4GUXA 1BB0B 4NZQA 3BV9B 3UNQA 1AFQB 1GG6B 2ZIQH 1Z71A 1NRQH 2ZGXH 3ODFA 2B8OH 4FU7A 5BRRE 1P3EA 1RS0A 3H5CB 4GVUA 1HIAA 1P9UA 3A81A 3RU4T 4CR9A 4NG9H 1QB1A 1RRKA 3DFJA 5I46H 4ZHMU 1O2ZA 2Z9GA 3SHAH 4KELA 4NWLA 1DE7H 3TJUA 3QK1A 4DJZB 2A5IA 3TJVA 3QTOH 2A5AA 2BY9X 1QJ1B 4Y79A 1NRPH 5GWZA 2GMTB 2C93B 5A8XA 3N7OA 4LOYH 4NA9H 2P95A 2PR3A 1DUAA 1TGNA 3TK9A 1A0LA 1V3XA 1O5CB 1NRNH 1HCGA 3VGCC 3BEFB 2XBXA 2GT7A 1C2EA 3MNBA 1N8OB 1SQAA 5E0JA 1ELBA 1TPPA 1YPGH 3BTKE 1O37A 2VVUA 3QN7A 4K60A 1QFKH 1A5IA 5T6FA 1JXPA 1KY9A 2BY8X 3HATH 3MNSA 4JK5A 5E8EH 1S5SA 2I6QA 5SGAE 4H6TA 1DX5M 2C4FH 1C1UH 1G30B 1YLCA 1O3DA 1O3GA 1T8OA 1VITH 2A1DB 6GCHF 1F0RA 4H6SB 1TQ0B 2PKSC 3A7XA 5DP5A 1GJ8B 3O8DA 3BTTE 1THRH 1A0JA 2ZC9H 1EJAA 3NKKA 3QZRA 6ESTA 4XOJA 3NXPA 2GT8A 3P8FA 5FX5A 2VINA 5ESTE 3PLPA 5EPNA 1GBAA 3OTJE 1V2NT 4B75A 1LKBA 2FTLE 4JYUH 2Q6FA 4CH2B 4I8GA 1C5WB 3VXFH 2EA3A 1O35A 1L1GA 1GI9B 1OOKB 5DP3A 3UR6A 1T8MA 5ABWA 1ZTLA 4I31A 2XW9A 1GBCA 1C1TA 1S6FA 2GCTC 4GSOA 2ZHWH 3PTNA 3DUXH 3RUOA 3M35A 2BLWA 4XFQA 2A2QH 4WH6A 3ZZ7A 1ZRBA 3SU0A 3K65B 4NFEA 1DY8A 1F5KU 2YNBA 3KEEA 2ZFPH 1MTWA 1AU8A 1FY5A 3SQEE 3K2UA 3BSQA 1MZAA 1O2IA 2ZPRA 1B7XB 1V2TT 3F1SB 4NFFA 5E2OA 1ELGA 1SLVB 1O5AB 3KQEA 4INHA 2ZFQH 1TBRH 3SNBA 3STJA 2XCNA 3MO3A 5ETXA 1RGQA 1O3HA 1AZ8A 4U32A 1AN1E 1DVAH 3VB4A 4I8LA 4JZIA 3GCTG 1F5LA 2ZTXA 1Z7KA 2BD7A 3ZVAA 4D8NA 4HTCH 1ZYOA 4U30A 4XE4A 1YPLH 1KXFA 1IQEA 1HAVA 4AOQA 1BMLA 1CE5A 1ETTH 4B76A 3ZVBA 3M7UA 3Q77A 1V2KT 3ZV8A 5TJXA 5EQSA 2O8WA 1E36B 1TX7A 1SOZA 4Z6AH 5FHTA 2BVSH 2ZPSA 4GHQA 5L2YH 4R0IA 1ELVA 2FLRH 2NU0E 3QGJA 1O3FA 2G5NA 2CMYA 4TPYA 3BG4C 3MOCA 4MNXA 1DLEA 1FY1A 1O3IA 2FOEA 1J16A 1ZLRA 1V2LT 3SZNA 3UWIA 3GY2A 3ATKA 3SNAA 3SV8A 4MNVA 2VWOA 3LDXH 2YOLA 1WCZA 4YT7H 1QB9A 1NT1A 3HKIB 3SNEA 1O5GH 1XM1A 1OWKA 2VGCB 1MTUA 2G8TA 4ZXXH 3VEQB 4E06H 5FXLA 1KXAA 1IOEA 4X1NU 3U69H 4NSYA 1ARBA 3ATIA 4X2XA 1IQLA 1JWTA 4X8UH 4Q7XA 3A85A 1X7AC 5C5NA 1LQDB 1UVTH 2AEIH 2G4TA 1LKAA 4D9QA 3BTFE 3RC5A 1RJXB 3HK6B 4BNRA 4XBDA 2FS8A 4UFFH 1ESTA 4SGBE 1INCA 3SU2A 4JYVH 5PTPA 5L2ZH 1GVLA 2PV9B 5T3HA 3GYMA 5K7RA 3QZQA 3VXEH 1YYY1 1EP5A 1T31A 3M5OA 1FAKH 3EDXB 3R3GB 2HNTC 1YPHC 1UVSH 1CT4E 2FXRA 1TQ7B 4DW2U 3LONA 3LGYA 1O2GH 3EAJA 3LC5A 3SBKA 2OD3B 4BXSA 1FLEE 3BTQE 1XXDA 3SN8A 1ELCA 2BY7X 1W2KH 1MTNC 1QHRB 1D9IA 1CU1A 1C5XB 3U98H 2GZ8A 3DD2H 3PM3A 5HM9A 2O8UA 3TITA 3OU0A 2OQUA 1C2IA 2F9UA 1F2SE 1C1OA 1KTSB 1Z8JB 1AE5A 3SI4H 4K1TA 5AF9H 1F92A 1ABIH 1ZPCA 1AE8H 3LT3A 1C1PA 3M7QA 3UY9A 5JBAS 3FANA 2Q6GA 3VB5A 3P70B 1D3QB 1FY8E 2O8TA 2WV4A 1C1NA 2HLCA 3TLOA 1UMAH 5FBIA 1HAIH 3F9EA 1WV7H 1F0SA 1BRAA 4UE7H 2G55A 1IQHA 2ZDVH 1C5LH 1HFDA 4X8SH 1GMCG 5CHAB 5C1YA 2JH6D 1UK3A 1IQNA 3V3MA 3UTUH 3GCOA 3QLPH 3A89A 5FPTA 3SU5A 3T2NA 5FAHA 1VGCB 1GMHF 1S85A 2ZU3A 1T32A 4J2YB 2A4RA 1A7SA 1FJSA 3GY8A 3I78A 1OWIA 1TOCB 2O8LA 2J92A 3LJJA 4FUEA 5EOKA 1BHXB 4Q7YA 3W95A 3EA9A 4Y76A 4B71A 1YPMH 4NIVA 4NIYA 3KF2A 1Z8RA 1CGIE 2ZFTA 2ODQA 2GKVE 1GJ9B 1WOFA 1VCPA 2H1UA 2G5VA 2CXVA 3VB3A 1GHBG 3GY7A 2BDHA 3MTYA 4AFZA 3ZZBA 1QA0A 2XRCA 1SGPE 3ZZCA 5DP7A 2RG3A 2VIPA 1P11E 3RM0H 1BBRE 4K3JA 1YC0A 4CR5A 2Z9KA 4K8BA 1ZMJA 2FX6A 2GV6A 1BBRK 4MPXA 5FCKA 3QWCH 5JYIA 2F9BH 1UK2A 1K21H 3ENSB 2SGFE 1SPJA 4YLQH 2F3CE 2OXSA 1HBTH 3PMAB 1SGYE 2FOGA 3BN9A 4D7FA 2A4QA 2Z3CA 1RTKA 4GHTA 2NU1E 1DS2E 2JH0D 3A84A 1G2LA 1CHGA 2H9EH 3RDZA 1GI8B 2GMTC 1Q31A 2IPHA 4AB8A 1O2VA 3UFAA 1ZTJA 3SI3H 3T28A 1DSUA 2A4GA 2FI5E 1HPGA 2SGPE 3BG8A 2F9OA 1O5FH 2ZDMA 3NWUA 1FNIA 4WH8A 1MTSA 1EOLA 2ANKH 7ESTE 1P04A 1QRWA 1LVMA 3SU3A 1W13U 2BVRH 1DM4B 1DUEA 2FDAA 3TU7H 3ELAH 1GI0A 1PJPA 8ESTE 1UO6A 1L1JA 3M37A 3RXUA 2ZGCA 1TB6H 3LH1A 2FEQH 2PWXA 1EOJA 4AFUA 2V0BA 1E37B 1PQ8A 1UHBA 4E7RG 1OKXA 3ZZ5A 1YM0A 1A61H 1C5RA 1YPKH 4AGKA 1XKBC 1C5YB 5J4QA 1J14A 1O30A 4Y11E 2HNTF 1EZSC 1O3MA 1FN6A 1MAYA 1SGIB 1WBGB 1UTPA 2QN5T 4O97A 3VFEA 2TRMA 1C1RA 3TGJE 3W94A 3EE0B 5C1XA 3S7KB 3Q3XA 1TA6A 4INKA 2C90B 2ULLA 2H6MA 1Y5BT 2RDLA 2TGDA 4RN6A 1H1BA 3A8AA 1Y3XA 1KTTB 4YM9A 3UQVA 1SC8U 1ZJDA 1PPFE 1AGJA 1QNJA 1MCVA 3PLKA 4RSPA 3A7VA 1ZGIA 1MCTA 1FONA 2Q6DA 1CHOG 1EZXC 2GCTB 4BTIB 2BYAX 4XSKU 1WSSH 2GCHF 2VH0A 1PPEE 2ZGHA 1SGQE 1S0RA 1M9UA 2ZG0H 3UIRA 3RXIA 2H9TH 4ZKSU 4THNH 2OBQA 2NU4E 5EODA 1K1PA 3A7ZA 1O2SA 1C2KA 1GWAA 1GBDA 5LPFA 2B0FA 1GBEA 2BDCA 4ABAA 2VJ1A 1GBKA 3KQCA 3B23B 3JZ2B 1D4PB 2TGPZ 3M36A 5EGMA 2BDBA 1ZMLA 3M3TA 3MU8A 3PV4A 3RXQA 1BTUA 1BTYA 3LPRA 1AWFH 1EX3A 2Q1JA 3UREA 4OS7A 2AMPA 2OCVB 2GZ9A 5F6MA 4UONA 2EC9H 1EKBB 4Y0ZE 4X1QU 2H5CA 1EAUA
chains in the Genus database with same CATH superfamily
1W8BH 4YZUA 2ZDLA 4IN1A 3RC6A 3UOUA 3PV5A 1GCTC 5GPIB 1T8LA 1A1RA 1Z8GA 3C27B 2QCYA 3GISB 1TWXB 3DCLA 1QL7A 3AAUA 1V2UT 5A0BA 1TGCA 5FBEA 1DWCH 4O3TA 2CV3A 2AERH 3U1IB 1MU6B 4U2WA 1YWUA 4WMEA 1DWDH 1SG8B 1C2HA 2FOCA 3E91A 1C5SA 3VGCB 1WAYB 4Y7AA 1HNEE 1SQRA 1SVPA 1XVOA 1PQAA 1ZRKA 2PFEA 2UWPA 1SLUB 3U8RH 4YXWD 3F2GA 1NS3A 4XDEA 5TCAA 1GBFA 3LOXA 4WWYA 3RP2A 2BQWB 3SO3A 2BLOA 1YBWA 3A86A 3GS9A 3RXEA 1O2YA 3EQ0H 2ODPA 3KNXA 2J95A 4X1PU 1Q3XA 1AO5A 5I25A 1ELFA 4ZCNA 4NWKA 5GIBA 1ANBA 2FP7B 1KMHB 4FUHA 4KTSA 4GLYA 3GY3A 1GVKB 1GBTA 2PTCE 3PYHA 3KCGH 2VIQA 3OEED 1TPSA 3LH3A 1C5OH 1H8HD 3L33A 4YO9A 4NGAH 1YLDA 4BAHB 3RXLA 2ASUB 3GDUA 1V2OT 5EQRA 5LPRA 2VU8E 4OS2A 4B2AA 2JETC 2JKHA 3V0XA 1OWEA 3CS7A 1SL3A 3EA8A 4ZXYH 1C4Y2 2V3MA 4MPVA 1C1QA 1HDTH 1SGFA 5GDSH 3QUMP 1MMJN 4NCYA 3SGAE 1NFXA 1LMWB 2B9LA 4CH8B 2WPKS 2Z9IA 1BRUP 2R3YA 1WTHD 1QGFA 5JBTA 1O5DH 4Y8XA 4E05H 1YP9A 2KAIB 5AFZH 4M9FA 3PWBA 1S84A 2BLQA 1TNKA 1O2UA 7LPRA 2JJ2D 1AZZA 2LNCA 1O0DH 3U8OH 1NFYA 3FP7E 4RT0A 1QBVH 1O3NA 1BTPA 3GDSA 2P3FH 1GJBB 1C1VH 3KHVA 1DICA 2C8ZB 5DGJA 3D65E 1JMOH 1Y3UA 3MNXA 3A88A 1G3DA 1AI8H 2J94A 1F0UA 5DSFA 1NRSH 1TMBH 4X1SU 2QY0B 4UFDH 2ALPA 2JETB 1IQMA 1XKAC 3ZV9A 3AW0A 2Y5GA 3GCHB 1Z6JH 1P3CA 3PMBB 1GL1A 3TGKE 2Y5HA 1D6WA 2JDID 1W0JD 1V2WT 1XUGA 4ZHAA 3ZVCA 2R0KA 2AMDA 3KGPA 3B9FH 3GCHC 4MPWA 3O8BA 1ZPBA 2PUQH 2ZTYA 1O5BB 1V2RT 2GX4A 5C5OA 4A7IB 2NU2E 1SGDE 3NPSA 2PP6A 5C3NA 4MVNA 2WV9A 2BQ7B 4DGJA 2ZZUH 1NY22 4I32A 1OP8A 4TSFD 1YCPH 3TJNA 1ZHPA 2PGQB 3MWIU 2M5TA 1C1WH 2GTBA 1GGDB 1VITF 1QY6A 1AQ7A 1JOUB 1GBLA 1VR1H 5IYTA 5C67A 5CHAC 1K22H 1QBOA 3LGVA 4ZKOU 5HKKD 4FUBA 5A09A 4B1TA 3PB1E 5C17A 3KYFA 3PMJA 4JK6A 4O9VA 4JMYA 2BLVA 5EXMA 1DSTA 1K1IA 2B5TB 4CHAB 5JB8S 1TOMH 2UWLA 3BF6H 1JRSA 1V2QT 1ETSH 3P17H 1HJ8A 1AB9B 4AYVB 3GY6A 5EG4A 3RC4A 3RLWH 1L4DA 2Y7XA 3OX7U 1MD7A 2EI6A 2VIWA 5L6NH 1KLIH 1NTPA 1P2KA 1VGCC 2BVXH 1A5HA 1TABE 1LDTT 2TPIZ 1AVGH 3AW1A 1NO9H 4TWYA 2QXJA 4O3UA 3ZVDA 4B2BA 4B6EA 1E0FD 3PWCA 3SJ9A 1WXRA 2QAAA 4PROA 1JRTA 3RXAA 5JDUB 1G3EA 1J8AA 2SGAA 1B0FA 1GHBF 1O3PB 2RA3A 2VNTA 4UEHH 2HPPH 2QC2A 1HB0B 1TALA 3U9AH 1O2RA 4E7NA 1OPHB 4CRBA 2FOMB 5T6DA 3F6UH 4GAWA 3RMNH 1EZUC 5K0HA 1TPOA 2DE8A 4JZEH 1GMDF 1FQ3A 4K69A 4XBCA 1Z6EA 1A4WH 2J2UA 2VVVA 3H09A 2XYAA 3VB7A 2R3UA 3DT0H 2OC0A 3P8GA 1C5VA 1LHFH 1K1JA 3P92A 2P94A 4RKJB 1TONA 2CHAC 2ANMH 1GJDB 2KCOA 2W26A 2PKSB 3BIUH 1QRXA 1BMAA 1H8ED 1TNGA 2FI4E 1BIOA 1XX9A 2FS9A 4OS6A 5C0TA 2ZHQH 1IQFA 2VGCC 2QF0A 3AASA 2PKAA 4K2YA 1CVWH 1GPZA 4XBBA 1TLDA 1LO6A 2UUKB 1ZGVA 1N6XA 1VJ9U 3MYWA 2J4IA 1ZOMA 4CBOA 3TPIZ 2BXUH 1C1SA 3NZIA 1W7GH 3OEHD 1NZQH 4X2YA 2ZDKA 4H4FA 3TK5A 4ZROA 1NBMD 2OC8A 2J98A 1LQEA 1HJAC 1P2OA 2ZDNA 4BTTB 4IN2A 1O2JA 1UTNA 2F9PA 3FO8D 2A2XH 1UTKA 2AIQA 1FAXA 4A1VA 5DP9A 2W7SA 3UNRA 1O2LA 3ESTA 1A5GH 3SHCH 3IWMA 3M61U 1LHGH 3SYJA 3TIUA 1GBBA 3ZVFA 1SGEE 2NU3E 4F55A 1YPHE 2HNTE 2ZF0H 2XTTB 1EQ9A 1S6LA 1O3EA 4INLA 1NROH 2FYRA 1SFQB 2SGDE 4D9RA 1MZDA 2BMGB 1E1QD 2UUYA 1BT7A 1DT2A 1MTNB 1AB9C 2WHXA 1EP6A 1SHYA 2FIRH 1SB1H 1C9PA 4NA7A 1MAXA 1MKXK 1GHXH 3LC3A 1ETRH 1HV7A 1O3KA 4GCHF 5L30H 1BQYA 3M5NA 3U8TH 1OP0A 1Q2WA 1IQKA 3MI4A 1GL0E 3M7TA 1L2EA 2A31A 1O3LA 2QF4A 5HIYA 4Y0YE 1O2QA 1ZSKA 2TIOA 3P95A 3B8JA 1QR3E 2XOKD 2Z3DA 1GI7B 2ZCLP 2FODA 2UUFB 3WY8A 4ACAA 5EW1H 2HGTH 5DP8A 1HLTH 5EJLA 3A80A 3FAOA 3M5MA 2AIPA 2W3KA 1A2CH 3GY5A 3SV2H 4FU8A 1TGTA 3TVJB 2Y82A 3Q3YA 1Z8IB 2WPHS 4AYYB 4X6OA 2SNVA 1QA7A 4LK4A 3VB6A 2F9NA 2C8YB 3NUMA 1P03A 1EUFA 3F0OA 1AKSA 1O3JA 1LPZB 4Z0KA 4FUDA 1GJCB 1FV9A 1UTOA 4AFQA 2KAIA 2A7CA 1OWJA 2ZPQA 1XUIA 2EQNA 3R0FA 2ZCHP 1TNIA 2P8OB 2BOHB 4X8TH 1WU1A 2SGQE 2ZI2H 2BX3A 1OSSA 4U01A 2BY5X 2R9PA 3K6ZA 3DA9B 2ZHDA 3TH2H 2L74A 1KDQA 5GCHF 1QL9A 2A5KA 2D26C 1UVOA 2AGGX 3SJIA 2ZGJA 1G9IE 2ZECA 4TY6A 4WF8A 2UWOA 2XBVA 2BD5A 1TYNA 3MH4A 1C5MD 2BQ6B 4I7YH 1GDNA 4X0WU 3Q3KA 3LGUA 3MMGA 1PYTD 1S6HA 4Q4LA 3MO9A 3RXKA 1FN8A 2BZ6H 2D1JA 3MH6A 1FDPA 1XUFA 2ANYA 4UDWH 5IDKA 1RTLA 1XUKA 3RU4E 3RXPA 1HUTH 1P0SH 4MTBA 4KKDA 1SMFE 2BZAA 4NIXA 4AG2A 4DIIH 4ZKNU 1WYKA 3UUZA 1O39A 4WXIA 1S81A 1GJAB 1C5NH 1NFWA 2KCPA 2Y80A 3HK3B 1K2I1 2ZP0H 1BTHH 4FUIA 6CHAB 4DIHH 1IQIA 1FPHH 3TK6A 3ZZAA 5HYOA 1O2TA 2ZKSA 1FZZA 1PPCE 2G52A 4M7GA 6CHAC 3EE7A 3FZZA 4F48B 2PGBB 1IHSH 1QBNA 2Y6TA 3NCLA 2G4UA 1ZTKA 1WTGH 1HJAB 1LCYA 1P05A 1K1MA 2OINA 4B6FA 2H5DA 1CHOF 4FVBA 4CRDA 1HAZB 1C5UA 4ZMAH 4I8KA 1FPCH 3T29A 2AH4X 1B5GH 1SFIA 2XNIA 1GMHG 4CHAC 2EY4C 1C1MA 2BD3A 1CO7E 1BRCE 3QTVH 4AGJA 4BAKB 2F9VA 2PTNA 3F9HA 1ZSLA 3PO1C 1J17T 3O8CA 3H7TA 4X1RU 4Z1MD 5C20A 1LTOA 1MD8A 5KEDA 3EGKH 1ZMNA 3DSGA 5LGOA 1QL8A 2J97A 2PW8H 5G4BA 3L3TA 2Z9JA 4ABDA 3ATMA 1BA8B 1TNLA 5GJ4B 2J9NA 3KQ5A 1K1NA 1G2MA 2Y7ZA 1FMGA 2IOTA 2XXLA 3OY6U 4HI3A 4F49A 4ABBA 1MABB 2FOFA 2XWAA 2J98B 4GCHG 3T26A 3A8BA 1EB2A 1WUNH 1OP2A 3LKWA 1O33A 2P3UB 3OYPA 2J38A 1KXEA 3S69A 5HM2A 1OWHA 1EAWA 1V2VT 2DE9A 2QYIA 3T25A 2R2WU 2V7QD 3ZZ9A 1YPEH 1H8IH 2VWNA 2QXIA 2GV7A 3F68H 3SJOA 1YLNA 3BG4B 2WSSD 1O2MA 1ZZZA 2FO9A 4MG3A 5A8YA 1AUJA 2PKAB 3GDVA 3T5FH 4TWWA 3F9GA 5DO4H 1T8NA 2XC4A 2Z94A 2O9QA 1UHBB 4K1SA 2FX4A 2K1QA 1YF4A 5GCHG 2NWNA 2ZHEH 2V35A 2STAE 4BAOB 2FESH 2GP9B 3SJ8A 2KX4A 4H42U 1SHHB 1F0TA 4A5TS 3U1JB 3HKJB 1C4U2 1P8VC 1GJ4H 2AYWA 4ISLA 4P00A 3MQKC 2FM2A 4IC6A 1AY6H 1QQUA 1W3CA 5F03A 1C2LA 3KL6A 2FLBH 3LGTA 1FY4A 1P01A 2ALVA 1MKXH 1BCUH 1QJ7B 1DXPA 4NA8A 5F53A 1LPKB 1O2KA 1O3OA 1AFEH 5AHGH 1DXWA 1C2DA 2LPRA 2V3OH 3RXVA 2KFWA 3ZZ6A 3F0PA 5T6GA 2THFB 2FOAA 2TGTA 4YTAA 1L4ZA 3MH5A 3SU4A 2ILNA 2V3HH 3ZYEA 4WY3A 5C2ZA 4OS1A 3GYLB 4FUGA 4ZAEA 2ZU4A 2OUAA 2ZU1A 3BTHE 1D3TB 1YCPM 1PQ7A 1E35B 5IK2D 1LHDH 4Y6DA 1Y8TA 1UTLM 1O5EH 2BD8A 1P9SA 5DPAA 1MQ6A 1ANEA 1O2OA 1PPGE 1KSNA 2OC1A 1H9LB 1K28D 4FXGH 3CNRA 1O2NA 4I33A 2PUXB 4ABHA 2ZCKP 1ZSJA 1L1NA 4MDSA 4MNYA 3P6ZB 3DSOA 4ZH8A 2RFKC 2KR7A 3LU9B 1AIXH 2XWBI 3URCA 2G51A 1UTJA 1BMMH 3G01A 1TBZH 3FN8A 2BHGA 3UOPA 1HYLA 1SGNE 1Z1IA 3D62A 4NSVA 2YNAA 1LHEH 1NM6A 3RM2H 1FX0B 2BD9A 4UFGH 3TJOA 5DP6A 4JCNA 3E0NB 3RXGA 1V2PT 1WQVH 1IQJA 4LZ1H 1L0ZA 1AUTC 2I6SA 4X6MA 2ANWA 3A7TA 1P12E 1HAHH 2D2DA 3MH7A 1RXPA 1VKYA 3K6YA 5A2MH 2HALA 2QXGA 3UWJH 5C94A 1C5QA 5F8ZA 4BOHA 1AMHA 4A1TA 1GHAF 1V6DA 2A32A 3QX5H 1Y3WA 3E3TA 5E0GA 3RXCA 1P02A 3ZZDA 3BTGE 1THSH 1GHYH 5DKMA 4ISOA 2XBWA 1ANDA 1HXFH 1CA8B 1ANCA 1G3BA 4ZKRU 3UPEA 4IMZA 2BDGA 1P09A 4AB9A 4BTUB 2XNDD 5AFYH 1GI5A 1GCDA 1OYTH 4OS5A 2C8XB 2G00A 1A0HB 1TA2A 2SFAA 2WINI 2CJIA 2HVXA 1HAOH 1CA0B 1TIOA 5B6OA 3QO6A 1QZ8A 1ARCA 2Z7FE 1FI8A 3BTEE 1TRYA 4FVDA 1U6QA 1MUEB 1XUJA 1JIMA 3SU6A 1PFXC 1DFPA 1QTFA 1ZHMA 1J15A 1O34A 2ZFRH 2ZFSA 3CS0A 4I8JA 4X2WA 4D76A 2A7HA 1O2PA 3CENA 1WQSA 2BOKA 1NU9A 1P57B 1XXFA 3FP6E 2ESTE 3A7WA 1EJMA 1C2GA 1LVBA 5H4IB 2EEKA 2GGVB 3Q00A 4DVAU 1G3CA 4IC5A 3RMOH 3MNCA 2VB0A 1D6RA 1BJVA 5C1UA 3ZVGA 3SJKA 2AGIX 2H2ZA 1AKSB 1GHWH 1XVMA 2GZ7A 1KXDA 9LPRA 3ODDA 2PHBA 1GG6C 3T62A 2P8OC 5E0HA 4TT3D 2BTCE 1A3EH 3BIVH 4JYTA 2AGEX 4DCDA 3URDA 3ATWA 1BTZA 4FUCA 4X6NA 1SGTA 3OAAD 4YESB 1BUIA 1C4V2 3HGNA 4TYDA 1IAUA 4RI0A 2ZEBA 3S7HB 3A8DA 3EYDA 1TX6A 2WPIS 1TGBA 1TNHA 4HGCA 4KGAA 1NU7B 4BAQB 5EIYA 1EAIA 2OLGA 1BMFD 1MKWH 2XC0A 1G36A 1GJ5H 1BRBE 3CP7A 2LELA 1HRTH 8GCHF 4K8YA 2A45B 3RLYH 5DG6A 2RDEA 1SQTA 3MU0A 2AS9A 4CBNA 4AN7A 2FMJA 4Y71A 1ABJH 4Y8YA 2ZDAH 1GBHA 2F83A 1GI6A 2WYGA 3ZZ8A 2JIZD 1AWHB 4WXVA 2VIDA 3F9FA 1BMNH 1BBRH 5CMXH 1ELAA 2O8MA 3GICB 1UJ1A 2F4LA 4BAMB 1SLXB 2Z9LA 1E38B 1O38A 1K9OE 4I8HA 3GCNA 5EPYA 3S9CA 1TRNA 2CK3D 8GCHG 1THPB 1GI1A 1C2FA 1VZQH 3FP8E 2GCHG 1H9HE 5ESBA 1HAVB 1EPTB 3UB0A 1GHAG 1S0QA 4K1EA 2WPDD 1FIZA 1KXBA 1G37A 1NPMA 3TNSA 7KMEH 1C5TA 2VVCA 3DHKH 1JIRA 1KLTA 4Q2KA 5C0UA 1MKWK 1W0ZU 4YT6H 4CREA 1UW7A 5EXNA 5JBBS 3SOSA 1K0HA 2HOBA 1BOQA 1RD3B 1W0YH 1YY3A 1RFNA 2BX4A 4SGAE 2RCEA 1PYTC 1LVOA 5LH8A 4F4OC 2WV5A 1DWEH 3DFLA 2GDDA 4BXWA 1FXYA 1A46H 3RXFA 3OE7D 4GPGA 4DY7B 3EA7A 1GJ6A 5HXFA 1V2ST 3JZ1B 1Y3VA 4D7GA 3OTPA 3MU1A 4ABIA 3S0NA 1OXGA 2CN0H 1EZQA 5EJ1A 3AK5A 4Q63A 3E0PB 1LVYA 3A8CA 2F91A 1T4VH 1FUJA 3BTWE 1OYQA 5GNDA 1FY3A 1ELEE 3TH4H 2CF8H 1NFUA 1QJ6B 1TMUH 1H8DH 1NRRH 4FETA 1W7XH 1T7CA 2IJOB 1C9TA 4VGCC 1AFQC 2OBOA 3BTDE 8LPRA 2W5EA 3ITIA 2ZQ1A 1RIWC 2FTMA 3F2FA 3I29A 1QQ4A 4ESTE 4CRFA 4OGXA 1TBQH 1B0EA 1CA0C 1O36A 4A1XA 4IGDA 4K5ZA 2YMSC 1GCTB 9ESTA 2XBYA 1DOJA 3FOAA 3BTME 5B6LA 1UK4A 4UD9H 3M3VA 1HAPH 1MU8B 1AVWA 3P8NA 1NN6A 2IN2A 1AD8H 4A6LA 1AHTH 2QXHA 1CBWB 1SSXA 1UTQA 4X8VH 2BY6X 2EI8A 4MQAA 1QRZA 1GDUA 3SV9A 2BDIA 3RXTA 1O32A 1JBUH 4ASHA 1XUHA 4UFEH 1PPBH 3KIDU 1D3DB 4CRGA 4BANB 3V12A 2Z3EA 1YKTA 1TFXA 5A0AE 1EJNA 1ZR0A 2FOBA 1C5PA 5GXPA 1OHHD 2J34A 5HIZA 1E79D 1LHCH 1UTMA 3SV7A 1UCYK 2LP6A 3M5LA 1S82A 3L6PA 1CGJE 2CHAB 1OWDA 4DURA 4AORA 1P2QA 3T27A 1RIWB 1HGTH 4DOQA 4X6PA 3E16B 1P2JA 2EI7A 3OSYA 3SU1A 2SGEE 3SUDA 3PLBA 3HGPA 4RT1A 1GVZA 1W0KD 4WMFA 3S9BA 1BTXA 1P2IA 2PLXA 2P3TB 3MU4A 1HIAB 1ELTA 4MLFB 3RU4D 3SW2B 7GCHG 3ZZ4A 1HAYB 3MFJA 3QDZB 1TAWA 3H7OA 1ESAA 1H9IE 2OP9A 1N8OC 2P59A 2W6ID 3P8OA 4Y7BA 5HGGA 3TNTA 4JZ1A 3RXOA 2UUJB 3MHWU 1J9CH 4X2VA 3W1EA 2ZTZA 3SNDA 1EB1H 1SI5H 1Y5AT 2A7JA 1UCYE 1F7ZA 1GMCF 4J1YA 1Y59T 4ZUHA 2BD4A 4YOGA 2G81E 1DPOA 3OFND 1Y3YA 4IS5A 4ISHH 2R0LA 2BDYA 2Y81A 1O3CA 2OTVA 3PO1B 1W10U 4MPUA 3TGIE 1GDQA 3SUGA 5DK1A 1UCYH 1FIWA 3DSPA 1Y5UT 1TPAE 1E34B 3UR9A 1F5RA 3SV6A 1BZXE 4JZFH 1SBWA 2OC7A 5EQQA 2VWLA 3ZZ3A 4ZHLU 2OQ5A 3I77A 3N7EA 3VPKA 2FWWA 2W6JD 2HPQH 1H4WA 1ESBA 2VH6A 4R8TB 2IPQX 3RXHA 6GCHG 1TRMA 4ASUD 1GGDC 1HXEH 5FPYA 3STIA 3RXSA 4NZLA 2C8WB 3C1KA 1GI4A 1TNJA 1NC6A 2W7UA 3TH3H 4QT8C 4Q7ZA 4ISIH 4FOUC 4IBLH 2FPZA 2ZWLH 5CE1A 2WPMS 3RXDA 3V13A 1BITA 1SQOA 3GY4A 4YOJA 1GJ7B 2K8IA 1EATA 5EW2H 1GHZA 2B7DH 1ZJKA 2BXTH 1UVUH 1HAXB 3K9XB 1XMNB 4HZHA 1BDAA 1C5ZB 2V6NA 4OS4A 5KGOA 3SQHE 4Q80A 5LPEA 3BEUA 4KP0A 5F8TA 1IHTH 4RKOB 1DITH 2Z6BD 1K1LA 4ABEA 1DY9A 3MO6A 3V7TA 1CGHA 1O3AA 5CDFE 5BPEA 2STBE 3KYGA 1EPTA 4YOIA 3RMLH 4FUJA 1S83A 3LIWA 2VWMA 1RTFB 4B74A 2Y5FA 1EASA 3OY5U 1O2HA 1CT0E 1W12U 3NK8A 2RA0A 5FX6A 3O8RA 4ABGA 5JBCS 3PRBA 4VGCB 4AFSA 3D23A 1QIXB 4AG1A 4AX9H 1TX8A 4DG4A 2VIOA 3SGQE 1HJ9A 1KYNA 1PQ5A 1W11U 3KQDA 3UQOA 1SGFG 1CBWC 3HPTB 3Q76A 4WJG2 4MNWA 1YCPK 2BM2A 2HRVA 5EU8A 1V2MT 5FL7D 1PPHE 2AFQB 4FU9A 1ID5H 3ZYDA 1SR5C 3VG8A 1VITG 1QCPA 5FCRA 1CSOE 2BB4A 1LPGB 1O3BA 2HWLB 2ZFFH 1UVPA 2WPLS 3M3SA 1TGSZ 4KTUA 4O03A 1VCQA 5JB9S 2ZGBH 1BTWA 2D8WA 2K0QA 1GHVH 2BD2A 3ZVEA 3S9AA 2A0QB 3A82A 2AMQA 2KCYA 1TE0A 1GBMA 1CT2E 2BDAA 3UNSA 4JZDH 3E1XB 2WYJA 3E6PH 3RXRA 6LPRA 2QIQA 1C2JA 3LJOA 3ATLA 2WUBA 4AZ2B 3KQBA 3PMHB 1KXCA 3FFGA 1BJUA 2QA9E 1ZPZA 5EXLA 1HAGE 2JH5D 2PSXA 4ISNA 4WVPE 4HFPB 1SLWB 1YPJH 1GBJA 2XC5A 1MBMA 4TPIZ 2QF3A 1OX1A 1ZHRA 4ABJA 1EPTC 1MTVA 2GVFA 3E8LA 3SUEA 4CRCA 1DDJA 1N6YA 1KDQB 1DANH 2ODYB 2SNWA 1ELDE 2ZO3H 1D3PB 3FVFB 4B73A 3LGWA 3U28C 3F3BA 3A7YA 2CF9H 1COWD 1KLJH 2TBSA 3SGBE 4Y8ZA 7GCHF 1O2WA 1P10A 1W14U 1YGCH 2AHME 2GDEH 2ZU5A 3KN2A 1AVXA 2P16A 1VCWA 3PTBA 3QGNB 3RMMH 1TMTH 2P93A 3LGIA 3RXJA 4LZ4B 2GD4B 1ORFA 3N7DA 5FPSA 4KTCA 4FUFA 1MH0A 1QURH 2ZNKH 1QB6A 2ZHFH 5DJ7A 2FOHA 1GMDG 1V2JT 1GI3A 1N1LA 5HMAA 8KME2 2ZU2A 4B2CA 4TY7A 1P2MA 2R2MB 3A87A 1GBIA 4YLUA 3SNCA 3MU5A 2A4OA 2FYQA 2ZQ2A 4IMQA 3SORA 2C3SA 2FI3E 2DUCA 4DT7B 1P2NA 1EAXA 4LXBH 5A0CA 1BHXF 1PPZA 3D49H 4A92A 4OGYA 3FZDA 3GCTF 1DLKB 4Y10E 1VJAU 1SOTA 1G32B 1CQQA 1NESE 4ABFA 2W3IA 1KIGH 2CGAA 1P06A 2PSYA 1C2MA 4NIWA 3E90B 3AAVA 1O2XA 1MBQA 3GOVB 1DWBH 2FZZA 2QV1A 4CRAA 1A3BH 2WUCA 3IITA 1OS8A 2KZ4A 5JPMH 1K1OA 2VIVA 4HG6A 1O31A 3BEIB 2QGRA 5TCCA 5F8XA 1T4UH 1GI2A 5AVDA 3SUFA 2H9HA 2XCFA 1EXFA 2WPJS 1SGCA 1IQGA 1ACBE 2ZA5A 3AVZA 5DP4A 5E2PA 3RXBA 3A83A 1SGRE 1Z1JA 2TGAA 4WMDA 5A8ZA 4IW4E 3RXMA 3IG6B 1MQ5A 3WWBA 5J4SA 3PROA 4GUXA 1BB0B 4NZQA 3BV9B 3UNQA 1AFQB 1GG6B 2ZIQH 1Z71A 1NRQH 2ZGXH 3ODFA 2B8OH 4FU7A 5BRRE 1P3EA 1RS0A 3H5CB 4GVUA 1HIAA 1P9UA 3A81A 3RU4T 4CR9A 4NG9H 1QB1A 1RRKA 3DFJA 5I46H 4ZHMU 1O2ZA 2Z9GA 3SHAH 4KELA 4NWLA 1DE7H 3TJUA 3QK1A 4DJZB 2A5IA 3TJVA 3QTOH 2A5AA 2BY9X 1QJ1B 4Y79A 1NRPH 5GWZA 2GMTB 2C93B 5A8XA 3N7OA 4LOYH 4NA9H 2P95A 2PR3A 1DUAA 1TGNA 1EFRD 3TK9A 1A0LA 1V3XA 1O5CB 1NRNH 1HCGA 3VGCC 2J5UA 3BEFB 2QF5A 2XBXA 2GT7A 1C2EA 3MNBA 1N8OB 1SQAA 5E0JA 1ELBA 1TPPA 1YPGH 3BTKE 1O37A 2VVUA 3QN7A 4K60A 1QFKH 1A5IA 2GJGA 5T6FA 1JXPA 1KY9A 2BY8X 3HATH 3MNSA 4JK5A 5E8EH 1S5SA 2I6QA 5SGAE 4H6TA 1DX5M 2C4FH 1C1UH 1G30B 1YLCA 1O3DA 1O3GA 1T8OA 1VITH 2IJD1 2A1DB 6GCHF 1F0RA 4H6SB 1TQ0B 2PKSC 3A7XA 5DP5A 1GJ8B 1SKYE 3O8DA 3BTTE 1THRH 1A0JA 2ZC9H 1EJAA 3NKKA 3QZRA 6ESTA 4XOJA 3NXPA 2GT8A 3P8FA 5FX5A 2VINA 5ESTE 3PLPA 5EPNA 1GBAA 3OTJE 1V2NT 5EJZA 4B75A 4DT4A 1LKBA 2FTLE 4JYUH 2Q6FA 4CH2B 4I8GA 1C5WB 3VXFH 2EA3A 1O35A 1L1GA 1GI9B 1OOKB 5DP3A 3UR6A 1T8MA 5ABWA 5DN6D 1ZTLA 4I31A 2XW9A 1GBCA 2M2AA 1C1TA 1S6FA 2GCTC 4GSOA 2ZHWH 3PTNA 3DUXH 3RUOA 3M35A 2BLWA 4XFQA 2A2QH 4WH6A 3ZZ7A 1ZRBA 3SU0A 3K65B 4NFEA 1DY8A 1F5KU 2YNBA 3KEEA 2ZFPH 1MTWA 1AU8A 1FY5A 3SQEE 3K2UA 3BSQA 1MZAA 3PV2A 1O2IA 2ZPRA 1B7XB 1V2TT 3F1SB 4NFFA 5E2OA 1ELGA 1SLVB 1O5AB 3KQEA 4INHA 5CHBA 2ZFQH 2JJ1D 1TBRH 3SNBA 3STJA 2XCNA 3MO3A 5ETXA 1RGQA 1O3HA 1AZ8A 4U32A 1AN1E 1DVAH 3VB4A 4I8LA 4JZIA 3GCTG 1F5LA 2ZTXA 1Z7KA 2BD7A 3ZVAA 4D8NA 4HTCH 1ZYOA 4U30A 4XE4A 1YPLH 1KXFA 1IQEA 1HAVA 4AOQA 1BMLA 1CE5A 1ETTH 4B76A 3ZVBA 3M7UA 3Q77A 1V2KT 3ZV8A 5TJXA 5EQSA 2O8WA 1E36B 1TX7A 1SOZA 4Z6AH 5FHTA 2BVSH 2ZPSA 4GHQA 4XRNA 5L2YH 4R0IA 1ELVA 2FLRH 2NU0E 3QGJA 2VBCA 1O3FA 2G5NA 2KCAA 2CMYA 4TPYA 3BG4C 3PRDA 3MOCA 4MNXA 1DLEA 1FY1A 1O3IA 2FOEA 1J16A 1ZLRA 1V2LT 3SZNA 3UWIA 3GY2A 3ATKA 3SNAA 3SV8A 4MNVA 2VWOA 3LDXH 2YOLA 1WCZA 4YT7H 1QB9A 4ACBA 1NT1A 3HKIB 3SNEA 1O5GH 1XM1A 2OK5A 1OWKA 2VGCB 1MTUA 2G8TA 4ZXXH 3VEQB 4E06H 5FXLA 1KXAA 1IOEA 4X1NU 3U69H 4NSYA 1ARBA 3ATIA 4X2XA 1IQLA 1JWTA 4X8UH 4Q7XA 3A85A 1X7AC 2WZQA 5C5NA 1LQDB 1UVTH 2AEIH 2G4TA 1LKAA 1E1RD 4P02A 4D9QA 3BTFE 3RC5A 1RJXB 3HK6B 4BNRA 4XBDA 2FS8A 4UFFH 1ESTA 4SGBE 1INCA 3SU2A 4JYVH 5PTPA 5L2ZH 1GVLA 2PV9B 5T3HA 3GYMA 5K7RA 3QZQA 3VXEH 2F43B 1YYY1 3WW7A 1EP5A 1T31A 3M5OA 1FAKH 3EDXB 3R3GB 2HNTC 1YPHC 1UVSH 1CT4E 2FXRA 1TQ7B 4DW2U 3LONA 3LGYA 1O2GH 3EAJA 3LC5A 3SBKA 2OD3B 4BXSA 1FLEE 3BTQE 3WWFA 1XXDA 3SN8A 1ELCA 2BY7X 2L6OA 1W2KH 1MTNC 1QHRB 1D9IA 1CU1A 1C5XB 3U98H 2GZ8A 3DD2H 3PM3A 5HM9A 2O8UA 3TITA 3OU0A 2OQUA 1C2IA 2F9UA 1F2SE 1C1OA 1KTSB 1Z8JB 1AE5A 3SI4H 4K1TA 3ZIAD 5AF9H 1F92A 1ABIH 1ZPCA 2KM0A 1AE8H 3LT3A 1C1PA 3M7QA 3UY9A 5JBAS 3FANA 2Q6GA 3VB5A 3P70B 1D3QB 5T1VA 1FY8E 2O8TA 2WV4A 1C1NA 2HLCA 3TLOA 1UMAH 5FBIA 1HAIH 3F9EA 1WV7H 4I86A 1F0SA 1BRAA 4UE7H 2G55A 1IQHA 2ZDVH 1C5LH 1HFDA 4X8SH 1GMCG 5CHAB 5C1YA 2JH6D 1UK3A 1IQNA 3V3MA 3UTUH 3GCOA 3QLPH 3A89A 5FPTA 3SU5A 3T2NA 5FAHA 1VGCB 3FKSD 1GMHF 1S85A 2ZU3A 1T32A 4J2YB 2A4RA 1A7SA 1FJSA 3GY8A 3I78A 1OWIA 1TOCB 2O8LA 2J92A 3LJJA 4FUEA 5EOKA 3N99A 1BHXB 4Q7YA 3W95A 3EA9A 4Y76A 4B71A 1YPMH 5KECA 4NIVA 4NIYA 3KF2A 1Z8RA 1CGIE 2ZFTA 2ODQA 2GKVE 1GJ9B 1WOFA 1VCPA 2H1UA 2G5VA 2CXVA 3VB3A 1GHBG 3GY7A 2BDHA 3MTYA 4AFZA 3ZZBA 1QA0A 2XRCA 1SGPE 3F2HA 3ZZCA 5DP7A 2RG3A 2VIPA 1P11E 3RM0H 1BBRE 2HVYB 4K3JA 1YC0A 4CR5A 1WDIA 2Z9KA 4K8BA 1ZMJA 2FX6A 2GV6A 1BBRK 4MPXA 5FCKA 3QWCH 5JYIA 2F9BH 1UK2A 1K21H 3ENSB 4XD7D 2SGFE 1SPJA 4YLQH 2F3CE 2OXSA 1HBTH 3PMAB 1SGYE 2FOGA 3BN9A 4D7FA 2A4QA 2Z3CA 1RTKA 4GHTA 2NU1E 1DS2E 2YMSB 2JH0D 3A84A 1G2LA 1CHGA 2H9EH 3RDZA 1GI8B 2GMTC 1Q31A 2IPHA 4AB8A 1O2VA 3UFAA 1ZTJA 3SI3H 3T28A 1DSUA 2A4GA 2FI5E 3NRLA 1HPGA 2SGPE 3BG8A 2F9OA 1O5FH 2ZDMA 3NWUA 1FNIA 4WH8A 1MTSA 1EOLA 2ANKH 7ESTE 1P04A 1QRWA 1LVMA 3SU3A 1W13U 2BVRH 1DM4B 1DUEA 2FDAA 3TU7H 3ELAH 1GI0A 1PJPA 8ESTE 1UO6A 1L1JA 3M37A 3RXUA 2ZGCA 1TB6H 3LH1A 2FEQH 2PWXA 1EOJA 4AFUA 2V0BA 1E37B 1PQ8A 1UHBA 4E7RG 1OKXA 3ZZ5A 1YM0A 1A61H 1C5RA 1YPKH 4AGKA 1XKBC 3UAIC 4AC9A 1C5YB 1NBME 5J4QA 1J14A 1O30A 4Y11E 2HNTF 1EZSC 1O3MA 1FN6A 1MAYA 1SGIB 1WBGB 1UTPA 2QN5T 4O97A 3VFEA 2TRMA 1C1RA 3TGJE 3W94A 3EE0B 5C1XA 3S7KB 3Q3XA 1TA6A 4INKA 2C90B 2ULLA 2H6MA 4OM9A 1Y5BT 2RDLA 2TGDA 4RN6A 1H1BA 3A8AA 1Y3XA 1KTTB 4YM9A 3UQVA 1SC8U 1ZJDA 1PPFE 1AGJA 1QNJA 1MCVA 3PLKA 4RSPA 3A7VA 1ZGIA 1MCTA 1FONA 2Q6DA 1CHOG 1EZXC 2GCTB 4BTIB 2BYAX 4XSKU 1WSSH 2GCHF 2VH0A 1PPEE 2ZGHA 1SGQE 1S0RA 1M9UA 2ZG0H 3UIRA 2YMSD 3RXIA 2H9TH 4ZKSU 4THNH 2OBQA 2NU4E 5EODA 1K1PA 3A7ZA 1O2SA 1C2KA 1GWAA 1GBDA 5LPFA 2B0FA 1GBEA 2BDCA 4ABAA 2VJ1A 1GBKA 3KQCA 3B23B 3JZ2B 3SZEA 1D4PB 2QE7D 2TGPZ 3M36A 5EGMA 2BDBA 1ZMLA 3M3TA 3MU8A 3PV4A 3RXQA 1BTUA 1BTYA 3LPRA 1AWFH 1EX3A 2HLDD 2Q1JA 3UREA 4OS7A 2AMPA 2OCVB 2GZ9A 5F6MA 4UONA 2EC9H 1EKBB 4Y0ZE 4X1QU 2H5CA 1EAUA
chains in the Genus database with same CATH topology
1W8BH 4YZUA 2ZDLA 4IN1A 3RC6A 3UOUA 1GCTC 5GPIB 1T8LA 1A1RA 1Z8GA 3C27B 2QCYA 3GISB 1TWXB 1QL7A 3AAUA 1V2UT 5A0BA 1TGCA 5FBEA 1DWCH 4O3TA 2CV3A 2AERH 3U1IB 1MU6B 4U2WA 4WMEA 1DWDH 1SG8B 1C2HA 2FOCA 3E91A 1C5SA 3VGCB 1WAYB 4Y7AA 1HNEE 1SVPA 1XVOA 1PQAA 1ZRKA 2PFEA 2UWPA 1SLUB 3U8RH 1NS3A 4XDEA 5TCAA 1GBFA 3LOXA 4WWYA 3RP2A 2BQWB 3SO3A 2BLOA 1YBWA 3A86A 3RXEA 1O2YA 3EQ0H 2ODPA 3KNXA 2J95A 4X1PU 1Q3XA 1AO5A 5I25A 1ELFA 4NWKA 5GIBA 1ANBA 2FP7B 4FUHA 4KTSA 4GLYA 3GY3A 1GVKB 1GBTA 2PTCE 3PYHA 3KCGH 2VIQA 1TPSA 3LH3A 1C5OH 3L33A 4YO9A 4NGAH 1YLDA 4BAHB 3RXLA 2ASUB 3GDUA 1V2OT 5EQRA 5LPRA 2VU8E 4OS2A 4B2AA 2JETC 2JKHA 3V0XA 1OWEA 3CS7A 1SL3A 3EA8A 4ZXYH 1C4Y2 4MPVA 1C1QA 1HDTH 1SGFA 5GDSH 3QUMP 1MMJN 4NCYA 3SGAE 1NFXA 1LMWB 2B9LA 4CH8B 2WPKS 2Z9IA 1BRUP 2R3YA 1WTHD 1QGFA 5JBTA 1O5DH 4Y8XA 4E05H 1YP9A 2KAIB 5AFZH 3PWBA 1S84A 2BLQA 1TNKA 1O2UA 7LPRA 2LNCA 1AZZA 1O0DH 3U8OH 1NFYA 3FP7E 1QBVH 1O3NA 1BTPA 3GDSA 2P3FH 1GJBB 1C1VH 3KHVA 1DICA 2C8ZB 5DGJA 3D65E 1JMOH 1Y3UA 3MNXA 3A88A 1G3DA 1AI8H 2J94A 1F0UA 1NRSH 1TMBH 4X1SU 2QY0B 4UFDH 2ALPA 2JETB 1IQMA 1XKAC 3ZV9A 3AW0A 2Y5GA 3GCHB 1Z6JH 1P3CA 3PMBB 1GL1A 3TGKE 2Y5HA 1D6WA 1V2WT 1XUGA 4ZHAA 3ZVCA 2R0KA 2AMDA 3KGPA 3B9FH 3GCHC 4MPWA 3O8BA 1ZPBA 2PUQH 2ZTYA 1O5BB 1V2RT 2GX4A 5C5OA 4A7IB 2NU2E 1SGDE 3NPSA 5C3NA 4MVNA 2BQ7B 4DGJA 2ZZUH 1NY22 4I32A 1OP8A 1YCPH 3TJNA 1ZHPA 2PGQB 3MWIU 2M5TA 1C1WH 2GTBA 1GGDB 1VITF 1QY6A 1AQ7A 1JOUB 1GBLA 1VR1H 5IYTA 5C67A 5CHAC 1K22H 1QBOA 3LGVA 4ZKOU 4FUBA 5A09A 4B1TA 3PB1E 3PMJA 4JK6A 4O9VA 4JMYA 2BLVA 5EXMA 1DSTA 1K1IA 2B5TB 4CHAB 5JB8S 1TOMH 2UWLA 3BF6H 1JRSA 1V2QT 1ETSH 3P17H 1HJ8A 1AB9B 4AYVB 3GY6A 5EG4A 3RC4A 3RLWH 1L4DA 2Y7XA 3OX7U 1MD7A 2EI6A 2VIWA 5L6NH 1KLIH 1NTPA 1P2KA 1VGCC 2BVXH 1A5HA 1TABE 1LDTT 2TPIZ 1AVGH 3AW1A 1NO9H 4TWYA 2QXJA 4O3UA 3ZVDA 4B2BA 1E0FD 3PWCA 3SJ9A 2QAAA 4PROA 1JRTA 3RXAA 5JDUB 1G3EA 1J8AA 2SGAA 1B0FA 1GHBF 1O3PB 2RA3A 2VNTA 4UEHH 2HPPH 2QC2A 1HB0B 1TALA 3U9AH 1O2RA 4E7NA 1OPHB 4CRBA 2FOMB 5T6DA 3F6UH 4GAWA 3RMNH 1EZUC 5K0HA 1TPOA 2DE8A 4JZEH 1GMDF 1FQ3A 4K69A 4XBCA 1Z6EA 1A4WH 2J2UA 2VVVA 2XYAA 3VB7A 2R3UA 3DT0H 2OC0A 3P8GA 1C5VA 1LHFH 1K1JA 3P92A 2P94A 4RKJB 1TONA 2CHAC 2ANMH 1GJDB 2W26A 2PKSB 3BIUH 1QRXA 1BMAA 1TNGA 2FS9A 2FI4E 1BIOA 1XX9A 4OS6A 2ZHQH 1IQFA 2VGCC 2QF0A 3AASA 2PKAA 4K2YA 1CVWH 1GPZA 4XBBA 1TLDA 1LO6A 2UUKB 1ZGVA 1N6XA 1VJ9U 3MYWA 2J4IA 1ZOMA 4CBOA 3TPIZ 2BXUH 1C1SA 3NZIA 1W7GH 1NZQH 4X2YA 2ZDKA 4H4FA 3TK5A 4ZROA 2OC8A 1LQEA 1HJAC 1P2OA 2ZDNA 4BTTB 4IN2A 1O2JA 1UTNA 2F9PA 2A2XH 1UTKA 2AIQA 1FAXA 4A1VA 5DP9A 2W7SA 3UNRA 1O2LA 3ESTA 1A5GH 3SHCH 3IWMA 3M61U 1LHGH 3TIUA 3ZVFA 1GBBA 1SGEE 2NU3E 1YPHE 2HNTE 2ZF0H 2XTTB 1EQ9A 1O3EA 4INLA 1NROH 2FYRA 1SFQB 2SGDE 4D9RA 1MZDA 2BMGB 2UUYA 1BT7A 1DT2A 1MTNB 1AB9C 1EP6A 1SHYA 2FIRH 1SB1H 1C9PA 4NA7A 1MAXA 1MKXK 1GHXH 3LC3A 1ETRH 1HV7A 1O3KA 4GCHF 5L30H 1BQYA 3M5NA 3U8TH 1OP0A 1Q2WA 1IQKA 3MI4A 1GL0E 3M7TA 1L2EA 2A31A 1O3LA 4Y0YE 1O2QA 1ZSKA 2TIOA 3P95A 3B8JA 1QR3E 2Z3DA 1GI7B 2ZCLP 2FODA 2UUFB 3WY8A 5EW1H 2HGTH 5DP8A 1HLTH 3A80A 3FAOA 3M5MA 2AIPA 2W3KA 1A2CH 3GY5A 3SV2H 4FU8A 1TGTA 3TVJB 2Y82A 3Q3YA 1Z8IB 2WPHS 4AYYB 4X6OA 2SNVA 1QA7A 4LK4A 3VB6A 2F9NA 2C8YB 3NUMA 1P03A 1EUFA 1AKSA 1O3JA 1LPZB 4Z0KA 4FUDA 1GJCB 1FV9A 1UTOA 4AFQA 2KAIA 2A7CA 1OWJA 2ZPQA 1XUIA 3R0FA 2ZCHP 1TNIA 2P8OB 2BOHB 4X8TH 1WU1A 2SGQE 2ZI2H 2BX3A 1OSSA 4U01A 2BY5X 2R9PA 3K6ZA 3DA9B 2ZHDA 3TH2H 1KDQA 5GCHF 1QL9A 2A5KA 2D26C 1UVOA 2AGGX 3SJIA 2ZGJA 1G9IE 2ZECA 4TY6A 4WF8A 2UWOA 2XBVA 2BD5A 1TYNA 3MH4A 1C5MD 2BQ6B 4I7YH 1GDNA 4X0WU 3Q3KA 3LGUA 3MMGA 1PYTD 1S6HA 3MO9A 3RXKA 1FN8A 2BZ6H 2D1JA 3MH6A 1FDPA 1XUFA 2ANYA 4UDWH 5IDKA 1RTLA 1XUKA 3RU4E 3RXPA 1HUTH 1P0SH 4MTBA 4KKDA 1SMFE 2BZAA 4NIXA 4AG2A 4DIIH 4ZKNU 1WYKA 3UUZA 1O39A 4WXIA 1S81A 1GJAB 1C5NH 1NFWA 2Y80A 3HK3B 1K2I1 2ZP0H 1BTHH 4FUIA 6CHAB 4DIHH 1IQIA 1FPHH 3TK6A 3ZZAA 5HYOA 1O2TA 2ZKSA 1FZZA 1PPCE 2G52A 4M7GA 6CHAC 3FZZA 2PGBB 1IHSH 1QBNA 2Y6TA 3NCLA 2G4UA 1ZTKA 1WTGH 1HJAB 1LCYA 1P05A 1K1MA 2OINA 2H5DA 1CHOF 4FVBA 4CRDA 1HAZB 1C5UA 4ZMAH 4I8KA 1FPCH 3T29A 2AH4X 1B5GH 1SFIA 2XNIA 1GMHG 4CHAC 1C1MA 2BD3A 1CO7E 1BRCE 3QTVH 4AGJA 4BAKB 2F9VA 2PTNA 3F9HA 1ZSLA 3PO1C 1J17T 3O8CA 3H7TA 4X1RU 5C20A 1LTOA 1MD8A 3EGKH 1ZMNA 5LGOA 1QL8A 2PW8H 5G4BA 3L3TA 2Z9JA 4ABDA 3ATMA 1BA8B 1TNLA 5GJ4B 2J9NA 1K1NA 1G2MA 2Y7ZA 1FMGA 2IOTA 2XXLA 3OY6U 4HI3A 4F49A 4ABBA 2FOFA 2XWAA 4GCHG 3T26A 3A8BA 1EB2A 1WUNH 1OP2A 3LKWA 1O33A 2P3UB 3OYPA 2J38A 1KXEA 3S69A 5HM2A 1OWHA 1EAWA 1V2VT 2DE9A 2QYIA 3T25A 2R2WU 3ZZ9A 1YPEH 1H8IH 2VWNA 2QXIA 2GV7A 3F68H 3SJOA 3BG4B 1O2MA 1ZZZA 2FO9A 4MG3A 5A8YA 1AUJA 2PKAB 3GDVA 3T5FH 4TWWA 3F9GA 5DO4H 1T8NA 2XC4A 2Z94A 2O9QA 1UHBB 4K1SA 2FX4A 2K1QA 1YF4A 5GCHG 2NWNA 2ZHEH 2V35A 2STAE 4BAOB 2FESH 2GP9B 3SJ8A 4H42U 1SHHB 1F0TA 4A5TS 3U1JB 3HKJB 1C4U2 1P8VC 1GJ4H 2AYWA 4ISLA 2FM2A 4IC6A 1AY6H 1QQUA 1W3CA 5F03A 1C2LA 3KL6A 2FLBH 3LGTA 1FY4A 1P01A 2ALVA 1MKXH 1BCUH 1QJ7B 1DXPA 4NA8A 1LPKB 1O2KA 1O3OA 1AFEH 5AHGH 1DXWA 1C2DA 2LPRA 2V3OH 3RXVA 3ZZ6A 5T6GA 2THFB 2FOAA 2TGTA 4YTAA 1L4ZA 3MH5A 3SU4A 2ILNA 2V3HH 3ZYEA 4WY3A 5C2ZA 4OS1A 3GYLB 4FUGA 4ZAEA 2ZU4A 2OUAA 2ZU1A 3BTHE 1D3TB 1YCPM 1PQ7A 1E35B 1LHDH 4Y6DA 1Y8TA 1UTLM 1O5EH 2BD8A 1P9SA 5DPAA 1MQ6A 1ANEA 1O2OA 1PPGE 1KSNA 2OC1A 1H9LB 1K28D 4FXGH 1O2NA 4I33A 2PUXB 4ABHA 2ZCKP 1ZSJA 1L1NA 4MDSA 4MNYA 3P6ZB 4ZH8A 3LU9B 1AIXH 2XWBI 3URCA 2G51A 1UTJA 1BMMH 3G01A 1TBZH 2BHGA 3UOPA 1HYLA 1SGNE 1Z1IA 3D62A 4NSVA 2YNAA 1LHEH 1NM6A 3RM2H 2BD9A 4UFGH 3TJOA 5DP6A 4JCNA 3E0NB 3RXGA 1V2PT 1WQVH 1IQJA 4LZ1H 1L0ZA 1AUTC 2I6SA 4X6MA 2ANWA 3A7TA 1P12E 1HAHH 2D2DA 3MH7A 1RXPA 3K6YA 5A2MH 2HALA 2QXGA 3UWJH 1C5QA 5F8ZA 4BOHA 1AMHA 4A1TA 1GHAF 1V6DA 2A32A 3QX5H 1Y3WA 3E3TA 5E0GA 3RXCA 1P02A 3ZZDA 3BTGE 1THSH 1GHYH 5DKMA 4ISOA 2XBWA 1ANDA 1HXFH 1CA8B 1ANCA 1G3BA 4ZKRU 3UPEA 4IMZA 2BDGA 1P09A 4AB9A 4BTUB 5AFYH 1GI5A 1GCDA 1OYTH 4OS5A 2C8XB 2G00A 1A0HB 1TA2A 2SFAA 2WINI 2CJIA 2HVXA 1HAOH 1CA0B 1TIOA 5B6OA 3QO6A 1ARCA 2Z7FE 1FI8A 3BTEE 1TRYA 4FVDA 1U6QA 1MUEB 1XUJA 1JIMA 3SU6A 1PFXC 1DFPA 1QTFA 1ZHMA 1J15A 1O34A 2ZFRH 2ZFSA 3CS0A 4I8JA 4X2WA 4D76A 2A7HA 1O2PA 3CENA 1WQSA 2BOKA 1NU9A 1P57B 1XXFA 3FP6E 2ESTE 3A7WA 1EJMA 1C2GA 1LVBA 5H4IB 2EEKA 2GGVB 3Q00A 4DVAU 1G3CA 4IC5A 3RMOH 3MNCA 2VB0A 1D6RA 1BJVA 5C1UA 3ZVGA 3SJKA 2AGIX 2H2ZA 1AKSB 1GHWH 1XVMA 2GZ7A 1KXDA 9LPRA 3ODDA 2PHBA 1GG6C 3T62A 2P8OC 5E0HA 2BTCE 1A3EH 3BIVH 4JYTA 2AGEX 4DCDA 3URDA 3ATWA 1BTZA 4FUCA 4X6NA 1SGTA 4YESB 1BUIA 1C4V2 3HGNA 4TYDA 1IAUA 2ZEBA 3S7HB 3A8DA 3EYDA 1TX6A 2WPIS 1TGBA 1TNHA 4HGCA 4KGAA 1NU7B 4BAQB 1EAIA 2OLGA 1MKWH 2XC0A 1G36A 1GJ5H 1BRBE 3CP7A 1HRTH 8GCHF 4K8YA 2A45B 3RLYH 5DG6A 1SQTA 3MU0A 2AS9A 4CBNA 4AN7A 2FMJA 4Y71A 1ABJH 4Y8YA 2ZDAH 1GBHA 2F83A 1GI6A 2WYGA 3ZZ8A 1AWHB 4WXVA 2VIDA 3F9FA 1BMNH 1BBRH 5CMXH 1ELAA 2O8MA 3GICB 1UJ1A 4BAMB 1SLXB 2Z9LA 1E38B 1O38A 1K9OE 4I8HA 3GCNA 5EPYA 3S9CA 1TRNA 8GCHG 1THPB 1GI1A 1C2FA 1VZQH 3FP8E 2GCHG 1H9HE 5ESBA 1HAVB 1EPTB 1GHAG 1S0QA 4K1EA 1FIZA 1KXBA 1G37A 1NPMA 3TNSA 7KMEH 1C5TA 2VVCA 3DHKH 1JIRA 1KLTA 4Q2KA 1MKWK 1W0ZU 4YT6H 4CREA 5EXNA 5JBBS 3SOSA 2HOBA 1BOQA 1RD3B 1W0YH 1RFNA 2BX4A 4SGAE 2RCEA 1PYTC 1LVOA 5LH8A 4F4OC 2WV5A 1DWEH 3DFLA 2GDDA 4BXWA 1FXYA 1A46H 3RXFA 4GPGA 4DY7B 3EA7A 1GJ6A 5HXFA 1V2ST 3JZ1B 1Y3VA 4D7GA 4ABIA 3MU1A 3S0NA 1OXGA 2CN0H 1EZQA 3E0PB 1LVYA 3A8CA 2F91A 1T4VH 1FUJA 3BTWE 1OYQA 1FY3A 1ELEE 3TH4H 2CF8H 1NFUA 1QJ6B 1TMUH 1H8DH 1NRRH 1W7XH 1T7CA 2IJOB 1C9TA 4VGCC 1AFQC 2OBOA 3BTDE 8LPRA 2W5EA 3ITIA 2ZQ1A 1RIWC 2FTMA 3I29A 1QQ4A 4ESTE 4CRFA 4OGXA 1TBQH 1B0EA 1CA0C 1O36A 4A1XA 4IGDA 4K5ZA 1GCTB 9ESTA 2XBYA 1DOJA 3BTME 1UK4A 4UD9H 3M3VA 1HAPH 1MU8B 1AVWA 3P8NA 1NN6A 2IN2A 1AD8H 4A6LA 1AHTH 2QXHA 1CBWB 1SSXA 1UTQA 4X8VH 2BY6X 2EI8A 4MQAA 1QRZA 1GDUA 3SV9A 2BDIA 3RXTA 1O32A 1JBUH 4ASHA 1XUHA 4UFEH 1PPBH