9LDBA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldbA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldbA02
1JA9A 4NFYA 1C3VA 1YDEA 4CMCA 2IEBA 4K9DA 4YTEA 4MVJM 5DF1A 2JCVA 5ENDA 2NVWA 1AHIA 2D5AA 2VZ8A 4TVOA 1H2HA 4CJXA 4R41A 1ZKMA 2AMFA 1KIFA 1E3WB 4R9SA 4UVIA 1KYQA 2EKQA 1E3WA 1Q7GA 3G1TA 2IDZA 2UUPA 3GMSA 3K2BA 4DBZA 4OSOA 5CEJA 3BHJA 4E30A 4YAIA 3U5TA 4CMJA 3WBFA 3FNEA 3R0IA 4BO1A 2UYYA 4YT8A 4FJ0A 5DP2A 3SXPA 5L51A 2CSUA 3D3WA 2C20A 1DC4A 1QKIA 2G82A 2VHXA 1KEVA 3H5NA 5KVVA 5A03A 3PWKA 4FFNA 5IF3A 3U9LA 1SAYA 2Y1FA 4YRAA 2I66A 4FGSA 2GUGA 3NYWA 3BMNB 2OFPA 1NPTO 1UH5A 4R54A 4LRSB 1TT5B 2BGKA 4XRGA 1GR0A 2PNFA 4KP7A 1QMGA 3F46A 4NR0A 4BMSA 5F21A 4ID9A 4YJFB 4LSMA 3WQQA 3V1UA 1EBUA 2AXQA 2OUIA 5TS3A 1Y9AA 4GVXA 1B14A 3R6DA 3QHAA 1XWFA 3ETGA 2PZJA 3IDSA 4A03A 4ZJUA 5CPBA 4XR9A 3MJTA 6LDHA 1CWUA 4UUOA 2ZTMA 3LLSA 4E5MA 3G0OA 4IZHA 1PQPA 3FNHA 1BHSA 3UCXA 3B6ZA 4CLOB 4DLBA 4RVSA 1HDCA 5JLAA 3G17A 4A73A 4MPDA 5KNLA 3VC7A 3D0OA 3PDJA 3A9WA 2ZQYA 1DC3A 3PXXA 3RUEA 1TXGA 4FJ1A 3KEOA 2AQKA 2ZB3A 3RROA 3FI9A 4Z0TA 3VDRA 3I1JA 3I9LA 2Q2VA 1T2AA 5ES3A 4AFNA 3BYZA 1ZEJA 1SOWA 1E7YA 2OP0A 3I4FA 3M6IA 4N7RA 4BNIA 3RWBA 3UHAA 1YWGO 1NAHA 3DZFA 2P5YA 3DOJA 1GEEA 1OC4A 3EZLA 2I9PA 3KLPX 2JD2A 5TF4A 1SZJG 3U0BA 3HUDA 3F4BA 4RPHA 3QA9A 4G5HA 4CMGA 4URFA 4BNMA 2EKPA 1W4ZA 2BGMA 5COBA 3ROKA 4YA6A 4HWKA 3WMWA 2LDXA 2ZCVA 4KTVE 1H6BA 1PGNA 4EYEA 5JMWA 3EHEA 4CR7A 4RVDA 3OJOA 3D4NA 4MVJG 5H81A 2Y0EA 3NKLA 3S8MA 4CV0A 4NNJA 1NVMB 1PSDA 3VH1A 1YB4A 4MVJH 4LCJA 4NHEA 3JQ8B 1N5DA 1YB5A 1NVTA 5KKAA 1PTJA 2X86A 3Q2IA 4CM3A 2BI7A 5KKCA 1LDYA 4WEOA 3C1AA 7MDHA 1Z73A 3GEDA 3RIHA 1WWKA 4DC0A 3JD2A 4BGIA 1NPDA 4GMFA 3NTRA 3UKOA 1KEWA 1X1TA 3TFOA 3V2GA 3WTCA 3I9NA 3EW7A 2B35A 1K5HA 1JQBA 1ULUA 3FWNA 1Z75A 4UUMA 1A4UA 5AXAA 4TQGA 2DAPA 4MP3A 4K6FA 4AJIA 4DIBA 4GAEA 4IJWA 1LA2A 3W8FA 2VWHA 2DBRA 4R68A 1R4MB 2B37A 2B4RO 1DJQA 1YOVB 3VZSA 3BHMA 3I6QA 2YHUA 3BMOB 1UXGA 4ND1A 1ZXBA 1ARZA 1ID1A 2Z1MA 3ZN2A 5A5FA 1BWSA 4BV9A 1XELA 4CMKA 4RF3A 5JAQA 1NWHA 4F6LA 4M87A 1PS0A 1SB8A 2OGUA 2ZB8A 3JQEA 3GLQA 4UVHA 3IKTA 3MTJA 1EQ2A 3LT0A 1VJ1A 4PG6A 2CD9A 4M8SA 1DAOA 4FBGA 3JQCA 5G0WA 2X5JO 1YE3A 2AG8A 2O3QA 1A5ZA 3GGOA 1IUKA 1NQTA 3DL2A 3QP9A 2J3KA 3ONDA 3V1YA 3GQVA 3W4JA 4Z0HO 1HSZA 2PGLA 1GYRA 3EGOA 3S2IA 3W8DA 1M2WA 3VTFA 1HDRA 1I32A 4E2YA 1NFRA 2Y05A 1QYVA 1VSVA 3AUAA 1QYWA 3C7DB 4RLSA 4FFLA 2DQ4A 1JAYA 1GTMA 2ZYAA 1F8FA 3ADPA 5DN9A 1U3WA 4R51A 1NFQA 4CLXA 5BSFA 2QYTA 3R3SA 4YRBA 4R69A 4GL4A 4N5NA 2O3TA 1A7KA 1PIWA 4JBHA 1NTOA 1JWAB 3V1TC 5L53A 2C0CA 2W2LD 4GX5A 4WCFB 3ASVA 5IG2A 3SVTA 3DBRB 4FW8A 2HK7A 2GN6A 3WWZA 1UDAA 4G2NA 3HSKA 5GZ6A 4LGVA 1U5CA 1J6UA 5CEEA 1B0AA 4EUEA 1HXHA 2IYPA 1YOVA 4HNHA 3F1KA 4EGFA 3NGXA 2EKLA 1A72A 4XYEA 2CDCA 1K2WA 3X2FA 3ZNNA 3E82A 2C82A 3QRWA 4CUJA 5TNXA 4BO8A 4DTIA 4E21A 4BO4A 4GVLA 2OL4A 4RDHA 3MWEB 3L6OO 4J7CA 4OL9A 1UJMA 2GN8A 4QECA 4U7WA 1YDWA 4A7PA 3DZJA 1GV0A 2PWZA 3C3XA 5BSGA 3E5RA 4HP8A 1R0KA 4CV2A 3LT4A 3P19A 1GZ4A 3JQ7A 5CPFA 3U4CA 4WLVA 4II3A 1RKXA 3GRKA 3WSWA 2IXAA 1LLUA 2PZMA 3JTMA 2BI8A 5F3RA 1ADFA 2JKVA 4DQVA 2HK8A 4PLZA 2X9NA 3RU9A 1B2LA 3EAGA 5JW6A 1VM6A 1WZEA 2WDZA 3EZYA 3INTA 3JD1A 1AHHA 5JAMA 2X4GA 1UDBA 2DPHA 1MGOA 3EUWA 3L77A 4MVJE 4ZN6A 1PGQA 4FFMA 1E7RA 4BNVA 3QW2A 4B7UA 2PGDA 3RFXA 2P4HX 4NMHA 1B8UA 4HADA 4Q3DA 1Q2XA 4BQPA 4E5YA 3QVXA 5AXCA 1WDMA 3GGPA 4OYRA 4Z9FA 3AY3A 3RC9A 1BVUA 2IE0A 4P22A 1V8BA 5A05A 5MDHA 3WLEA 4BGVA 4R3WA 1NM5A 4J9VA 3RFVA 2Y0CA 5EERA 3UFXA 2D2IA 2PH5A 4TWRA 1VC2A 4QQRA 2NVUB 1DFHA 4GLLA 4WNCA 2RAFA 5BSHA 1Q0QA 2VUUA 3JQ7B 2Y1CA 2EHDA 4WUVA 3ZHXA 4K6CA 4NPCA 2TMDA 2O7SA 4R9RA 4AJKA 4EUHA 3V2HA 1ADBA 1PWZA 1WMAA 2AEMA 1DXYA 4FDAA 4RPJA 4B3HA 4E2ZA 4F3YA 4DMLA 2FN7A 1PX0A 3TRIA 1MA0A 2X0RA 1NQOA 1PL6A 5ITWA 3P2OA 1KY5A 4ND4A 3VH4A 2EJWA 1KEPA 4Q3AA 3O03A 4DA9A 2I67A 3PEFA 1B15A 1R16A 3P2YA 3ICPA 4Y6PA 4GSLA 1ADCA 4J49A 1T25A 3ADOA 1Q0LA 2DTEA 3GAFA 2QRKA 4NH4A 3DTTA 4BNKA 4QT0A 5HS6A 4CUKA 5JYDA 4NJOA 5DNAA 2D4AA 2DC1A 3UICA 4OXNA 3ZW9A 2CNBA 5EINA 1I01A 3O8QB 3AI3A 4HY3A 4PG8A 1HRDA 2YUTA 1MXHA 4PGFA 4B4WA 2DPGA 5I8ZA 3Q9UA 3B1KA 5TC4A 4NIMA 3HFSA 1PGPA 2B4TO 1LDBA 3H9GA 2A92A 3WJAA 4A5OA 2VCYA 4EDFA 4ALKA 4ZQHA 2R6JA 4L75A 3DZKA 2JL1A 5BT9A 3H7AA 5T64A 1P1JA 4DLLA 2OZPA 3AU8A 1OI7A 1NQAO 3VPSA 2Q4BA 4FOSA 2P68A 3HB5X 5IDXA 3EVTA 2GGSA 3KETA 1C1DA 3DHYA 1JVSA 3ITDA 5KJEA 3VAZA 3WGIA 3AK4A 1H6CA 2EP7A 3FN4A 4RCVA 4DWVA 3DR3A 5IZCA 3GG9A 1G0OA 1QV7A 4CLOA 4A26A 1HTBA 4ESOA 4AJPA 3PWSA 3NT4A 4RL6A 3TNLA 4D3SA 4OOFA 4XYGA 1UXJA 1E1KA 2VHVA 2OMEA 4WEQA 4DPKA 1U28A 1P1KA 1JTVA 1E1MA 1IE3A 2FWMX 5TQVA 1KVRA 2C59A 2EF1A 1U9JA 5ILOA 3AM5A 1WDKA 4PLPA 4RORA 1B26A 4RVFA 4PVCA 3TZQA 5LC1A 3OMLA 3OJLA 3VVCA 1NR7A 1GY8A 3U62A 4LN1A 1SMKA 4PLVA 3AU9A 1JKFA 5HBRA 4D0SA 5K0ZA 1IY8A 3KEQA 4YJHB 3ZV4A 2P4QA 5IDQA 3G49A 4D3FA 4TSKA 1AE1A 1VPDA 2CDAA 3OQ6A 1I2CA 2O50A 2X9VA 3S2FA 3AI2A 4W99A 1K89A 2X0IA 4C7KA 1NX6A 4BKRA 4PN3A 4CMEC 3WS7A 1ONNA 2D59A 3NTQA 1EQUA 1GQQA 1P1HA 1TI7A 4BNHA 2FPPA 4FIZA 2VYVA 1HE5A 5I9MA 3HZZA 1GQ2A 1HYHA 3C8MA 1C0IA 2EW8A 1K0UA 3VZQA 3GEGA 5TT0A 3VH2A 1LEHA 4HFRA 3B1FA 4WOJA 3QVTA 2NTNA 3VDQA 3ZU4A 3BTOA 4OHUA 1GYQA 2EG9A 3RFTA 1ZBQA 1LRKA 3C24A 2JD1A 4MVJP 4W4TA 9LDTA 1TT7A 1SC6A 2FMUA 3HDQA 5K6AA 1H2BA 2ET6A 1UAGA 1MB4A 3ABIA 3QWIA 1SOVA 3VOSA 1CQJA 2WE7A 4LMRA 3UF0A 2Q49A 3NTOA 3FPCA 3DBVO 1PU2A 2ZJ0A 1EVJA 1N7HA 4BNZA 4XD2A 1RJWA 1R12A 3ANLA 1UZNA 2UV8A 4IXTA 4CM8A 4AG3A 8ADHA 5JCXA 3QVOA 4EZBA 1SO8A 4M89A 3PHIA 3OA2A 3PIIA 1DB3A 1QLJA 2GN9A 3FSRA 3IUSA 4YVFA 3OJEA 2HJSA 3OHSX 5KJ1A 1XQ6A 3KRTA 3ZWOA 2W8ZA 1X0VA 3DBHA 3DZIA 4S1VA 2JJYA 4BMVA 2BFMA 1I30A 4N5LA 3ENKA 1K6IA 1E1NA 3BTSA 1BVRA 3K73O 3WFIA 3H2SA 4DYVA 1E6WA 3MOGA 1QR6A 3WX0A 3QWHA 5A04A 3F1LA 4OQZA 3TWOA 4UUNA 3KZVA 4B8WA 2C5EA 4EEZA 2LDBA 4KWHA 1A9YA 5K9ZA 4IJKA 4H15A 1Z82A 1KEUA 3BIOA 1Y8QB 4DGSA 3GVHA 1Y8QA 1CIVA 3RBXA 1RM4A 1GUFA 2BKAA 2NSDA 2NNLD 4RGBA 5AYVA 1E77A 1JN0A 5T8KC 1JVBA 1E0DA 3F3SA 4RV9A 3GN2A 3QLJA 2XAAA 4BO2A 1HL3A 3GNTA 3E8XA 1BGVA 1E7QA 1G6KA 3ZCXA 5B4UA 1LI4A 2XXBA 5U1PA 2C54A 3EC7A 4J2OA 5EJ2A 3JD4A 2EGGA 3U4IA 1E3LA 3ITKA 3GZNB 3PDUA 1BXZA 4E0BA 1L7EA 2IRWA 4Q9NA 2YY7A 3D5QA 4YT4A 1PR9A 3S2EA 1KC3A 4IQ0A 4XDYA 2WTBA 1YH3A 4WJZA 2FZEA 2CZCA 2GNAA 3Q3CA 3Q9NA 1P9LA 2G0TA 4XGKA 2VRCD 3OECA 4BNYA 3JYLA 4J3FA 1C1XA 3B1JA 5A9RA 5IZ4A 1ULSA 2OBYA 3JQBA 3ROQA 3VTZA 1I33A 1N1GA 4RZHA 5CP8A 3MEQA 2F00A 3JQGB 2RH4A 1FDWA 2JCYA 2I3GA 1LTHR 1LNQA 3L4BA 2Y68A 1DLJA 3QY9A 1YQXA 2X7HA 3CKYA 2B5VA 4E5PA 1U8FO 1F17A 3CZRA 4BKQA 1J4AA 4IUYA 1N8KA 4WASA 5BR7A 4PLYA 4R16A 3PQFA 5ENVA 3DDNA 3IP3A 2VYNA 4J2HA 4RPLA 4ZQEA 2GZ2A 2W4QA 4EJ0A 3KYDA 5ADHA 4BGEA 2X58A 1DAPA 4AICA 4J91A 5IXSA 1N9GB 3ONEA 4PFJA 3TQHA 3IC5A 2FR1A 3JYPA 3AM4A 2YDYA 3KSUA 3RC1A 3WTBA 1O0SA 3Q0EA 1PJ3A 3UAGA 1QYDA 2I5PO 3JD0A 4YQYA 4GWKA 1PEDA 3GFBA 5T8KA 2Q4EA 3GA0A 4WLOA 4E6PA 1M76A 5JDIA 1A9ZA 2VTEA 4BNXA 4RQUA 3UGKA 3WIDA 3AFMA 3VKUA 2HMWA 4FPXA 3SJUA 2AEFA 4I5DA 3ZNOA 3D5TA 2VZ9A 1ZK2A 3E18A 5A02A 1VL6A 1MV8A 4OAQA 4E2XA 2AHRA 3BMOA 3I9MA 1W6UA 2DTXA 3CIFA 3ZHBA 1Q7CA 2V6FA 3T7EA 5L4NA 4BO3A 4XJSA 4CQMA 1WW8A 2HCTA 2R00C 4PCVA 2C2XA 1RM3A 2Q2WA 1EVYA 1FDVA 1ENOA 2O2YA 4KDFA 2VZ0A 3A06A 1PJBA 4L73A 3W8EA 1PQUA 1QLHA 5DCUA 4NI5A 2Y66A 4JGBA 3OEWA 3WYCA 3QQPA 4CQLA 2G17A 4DUPA 4XB1A 1DIGA 5EQDA 3IKVA 3K31A 3INRA 4CM9D 3JQFA 4XGNA 2UVDA 1HLDA 1U1IA 3VHRA 2YHIB 5G0VA 4DPMA 1V3UA 5L95A 3WMXA 1F14A 1I10A 2GN4A 4IQGA 3NT2A 4RO0A 1VKOA 4OQYA 4Z0PA 2E6UX 3G3EA 3RSHA 4IDBA 5EL0A 1O5IA 4E4YA 2H1SA 2Z95A 3BMCA 3H8VA 4FD3A 5G0SA 3W4KA 4R1UA 1Y8RA 2IYOA 1BG6A 4IDGA 1GYPA 3AY7A 1VL0A 3EY4A 1KY4A 2ZYDA 3WGQA 3OJFA 1GL3A 1KBZA 1IZ9A 3I9OA 3G1UA 4O0LA 4XJTA 4JJGA 3JQDA 3V2UA 5CDYA 5LDHA 3DFZA 1E7SA 4CMEA 4OJNA 3I3OA 2CFCA 4I5EA 1U3TA 2E48A 5T6BA 4D79A 1L7DA 2A94A 1H5QA 2YQ5A 4J6FA 4RVUA 1KVQA 3D64A 3DZHA 5DCWA 3WYEA 1E5QA 3FNGA 4LCEA 4H3VA 4IQ8A 4HXYA 3ZDFA 3NDRA 5TJHA 1MFZA 3UUWA 3KBOA 4ZRMA 2FR8A 1HEUA 5CHEA 4C7JA 2NU8A 5DBFA 2VUTA 3E03A 2G5CA 4CLRA 2E49A 2Y93A 1UUFA 2Q45A 5IFLA 3TFQA 4IXWA 3HDHA 2EJVA 3I4CA 1K6JA 2BGLA 3F6YA 4KQWA 2IXBA 2X8LA 4M86A 3P5SA 3B70A 2YHIA 4R5HA 3WGHA 4UEJA 3Q11A 4FFRA 1LUAA 2RCYA 1M6WA 4NBWA 1T24A 4CLDA 3KOUA 2VUSA 5GMOA 3PVZA 1LLQA 1DIBA 3DTYA 5IXYA 2NU9A 2XXJA 3N58A 2FP4A 1JAXA 1YBMA 4O63O 1I3NA 1IPEA 2P9EA 3PI7A 3D3WB 5G2OA 3ZI0A 4H7PA 3LT2A 2JFGA 1DBVO 3K6JA 4O5OA 4XA8A 4R1SA 1IHXA 3TL3A 1Q0HA 1Z45A 2NU6A 2E37A 2JHGA 1FK8A 3BXXA 3T4EA 2I6TA 4ROSA 3WSVA 2PKQO 3E1KA 4FN4A 2ZB4A 4G81A 1LX6A 2D1YA 4ZA2A 1LSUA 4G65A 1O95A 4DVJA 3HN7A 5TT1A 4NK5A 1DRUA 2V6MA 5AQ1A 3GPDG 3GUYA 1Z6ZA 2WM3A 3COSA 3A1NA 4CMHA 3FD8A 1E6EA 1C0PA 2C07A 3ZW8A 4B3JA 3PQEA 1FMCA 2QW8A 3DOOA 4UVEA 2DKNA 3K9QO 4E5KA 3VPGA 5TJ9A 2VNSA 3SX2A 4TVBA 4UEOA 1PGOA 2J3IA 1MG0A 4BKOA 5JC1A 4RPKA 4M55A 3O26A 1UZMA 4IZIA 3ULKA 3FRJA 3WXBA 2O4CA 4PZCA 1E1LA 4YJHA 4DC1A 5C37A 5BNIA 3RUCA 3DAFA 2H5LA 4BNWA 3MCVA 3EK2A 2HMTA 3RVDA 3VPHA 2OO5A 4FQ8A 3RUDA 2WSBA 4BO9A 2Q1TA 2W90A 4GKVA 1EMDA 4YT5A 4YJDA 4DIFA 5KJ6A 5L9AA 1YB1A 2C7VA 4FSHA 3I9JA 2P2SA 3SLKA 1TLTA 3GDFA 3NAQA 2PD3A 2FPGA 1HE2A 2BELA 2Q2QA 2RIRA 4S3MA 1LRLA 1R4NB 1YBAA 4YRDA 3H5AA 2IEDA 4JXKA 3D3EA 5I9NA 4W82A 2R00A 2OXIA 2UDPA 1IOLA 2O3SA 1H0KA 3W4IA 3SC6A 1D8AA 4XB2A 1WXDA 1CQIA 4MIEA 5KVSA 5L7WA 1X7GA 3LC2O 4BB5A 3HNPA 1DOHA 1HZJA 3JD3A 4L74A 1YS4A 2EP5A 3VZPA 4BNGA 1FDTA 2FOIA 3K92A 5THQA 3M2TA 3LU1A 3OH8A 3NRCA 4QTZA 2AEJA 3VH3A 1DC6A 1P1FA 3DO5A 4IBOA 1ZJZA 1GPDG 5I8WA 2Y1EA 3Q6IA 5KVCA 3JQBC 1QRRA 3WNVA 1O89A 3JQ8A 1F0YA 4BKPA 3U09A 3GHHA 3OBBA 4JNKA 1HDXA 3FHLA 4ALNA 1LC3A 2YV1A 1T2DA 2Z1NA 1YXMA 3MOIA 4E13A 1B8PA 3EYWA 4OOEA 1YKFA 3RU7A 1RM0A 4II2A 3JQAB 1GAEO 2PD4A 3HJAA 1NHGA 3WGGA 4I08A 1DLIA 4DMMA 3LYLA 4C4OA 1R0SA 1NPYA 3PK0A 4YEDA 4E32A 3E9NA 4EW6A 4YCAA 3I9KA 2AW5A 3ZV5A 4MKRA 4MVJD 4KUGA 3GVPA 3CSDA 2VYVD 2WE8A 4ZRNA 4GGPA 1B16A 1HWYA 5BNTA 4EUFA 3ZGYA 3H65A 3QWAA 1JDJA 1R4MA 2DBVO 1XU7A 1Y6JA 2Y99A 3WQSB 1ZVMA 3AOGA 2DT5A 2JCXA 3VZRA 5G0TA 2TMGA 3DZBA 4XGIA 5HM8A 4L8VA 1FF9A 3PYMA 1ZK0A 2Y1OA 1U3VA 1AXGA 3DMTA 3GY0A 5A4DA 1NAIA 3RUAA 4XYMA 5G4KB 4BB6A 5JDIC 3CMCO 2QIOA 2GF2A 2ZIZA 1A71A 5EIOA 5JMPA 1SEPA 3WGZA 1ZMOA 4R1TA 5CAEA 4CQLB 3BA1A 2ZTLA 3G79A 1LRJA 4QO8A 1AXEA 2WYWA 1BTOA 2PLAA 1YVEI 4J90A 3KM0A 4HFJA 4ZVVA 4ZU3A 4CR8A 4OSPA 1IL0A 4ITUA 3NGLA 3GVXA 3GOHA 3LC1O 5F1KA 4KUEA 1PZEA 2I65A 4BVAA 2Y1GA 1B7GO 3WWYA 2VWGA 5ER9A 4HX5A 1EFLA 1R4NA 1CJCA 1S6YA 4QFDA 4PLWA 1NWCA 1NBOA 5BQFA 3V5NA 3A14A 3ZWXA 3WG9A 3RBZA 4XEHA 4QSMA 4F46A 1Y1PA 4J9UE 3E9QA 1TA4A 3QVSA 3F5SA 1SPXA 3GZ4A 4WK6A 3H3FA 2GLXA 2HMSA 2NV6A 1E5LA 4FFPA 4MVJI 3Q1LA 1LQUA 3ANMA 2D3TA 4BO7A 1ISFA 2HLPA 2NADA 4W9NA 1H9AA 1ENPA 4NU6A 1PR3A 4U8GA 2F1KA 2RHRA 2Y1DA 3C1OA 2JFHA 1H93A 1GFSA 2Q50A 2QZ9A 3OICA 3PHLA 2BFPA 2YV3A 2IZZA 4R01A 3TL2A 4P4GA 1YGYA 3GDGA 3QWBA 1F8GA 3IP1A 4JX8A 3ICCA 3PHJA 5B12A 3E48A 7ADHA 3KHUA 1N9GA 3ZWVA 3I52A 4Z3KA 4BV8A 2W2KA 1A4IA 3DONA 3GVIA 4JP3A 2V6GA 2YFQA 1E6UA 3OEYA 2PD6A 3K2EA 1E3SA 1KOLA 4PZEA 4BS9A 1I3KA 4B8ZA 2V6BA 1KS9A 2BLLA 3V8BA 2J6IA 2Q1WA 4WE3A 3LSYA 3BMNA 4HNGA 1FDSA 1GU7A 2FSVA 2PA3A 3KO8A 1M67A 3HB4X 1MX3A 3GN1A 4GSKA 4D0RA 4DREA 2EEZA 3O38A 3MTGA 4EEXA 3CXRA 4BO0A 2P9GA 4CM9A 4BQRA 1HSOA 1EDOA 4ILKA 1ZK3A 3FBGA 1HYGA 4OIMA 1M66A 4N18A 1QP8A 2BRUA 3EVNA 3GZNA 4NQZA 4QO7A 4XRRA 2EIHA 3HN2A 4Z9XA 1LSJA 1IB6A 3K5PA 4D45A 4QX6A 3EMKA 1PZHA 4J7UA 4LRTB 4Z9YA 3WR5A 5A9SB 2A4KA 2BFOA 4M1QA 4IGFA 5I9LA 4JQCA 5ILGA 2RHCA 3RUFA 2NVUA 1MC4A 1D3AA 3LK7A 4UVDA 4INAA 6ADHA 4I5GA 1DFGA 3ANNA 1GD1O 2ZYGA 3JQAD 3WNQA 2GYYA 4IIVA 3RD5A 3O8QA 2CVZA 1QV6A 1T26A 4TMFA 1U7HA 2PH3A 3BMQA 3JCZA 4D44A 2VRBA 4HV4A 4R5MA 3JQAA 2H6EA 3H5RA 1QXSA 2ZTUA 2FSSA 4BMNA 5IDWA 3B20A 4IMPA 4W6ZA 3L07A 5F5NA 3PHHA 4MVJF 1JW9B 1T4DA 1PJQA 1ISIA 5GZ3A 4IINA 2GZ1A 2GZ3A 2IZ0A 2X1HA 3RI3A 4HUJA 3FTNA 3LF1A 1H6DA 1PS8A 3S2GA 5C3MA 1CEQA 3WYBA 2JHFA 4D42A 1BXKA 2YW9A 3MJEA 4ALMA 4ZD6A 3GH3A 1ZNQO 3SLGA 1DSSG 1U4OA 4GKBA 3D4PA 4JJFA 3WOHA 3QE3A 4Q3EA 1FXSA 3FR7A 3TF5A 4J4BA 1GEGA 4EJ6A 2E4AA 3NV9A 4U5QA 3H4VA 5MGBA 3T4XA 1OC2A 1P77A 1UXKA 1BSVA 4JK3A 1I0ZA 4BO5A 4YQZA 4CM1A 5JC8A 4J1NA 1G1AA 1ENYA 4F45A 2PV7A 1I2ZA 2C29D 3ZHYA 2EWMA 2PTGA 3PZBA 2QRJA 2P5UA 1ZO8A 3FPLA 3W1VA 4CM8B 4J0EA 2P91A 4W7IA 3ENNA 1P0CA 2JD0A 2NLOA 4HFMA 2QG4A 3PP8A 1D7OA 5AOVA 1PJLA 3GF4A 5KWEA 3RASA 1JKIA 5DOVA 1ONOA 1LJ8A 2X0NA 4KUHA 2YZ7A 3BMQB 4YT2A 3PFFA 2CVOA 2ZCUA 1ZSVA 4L4SA 3TZHA 4P4LA 8LDHA 1X14A 4Y98A 1FJHA 1OMOA 3D7LA 4AJHA 4ALLA 4CQMB 3BTUA 1DHRA 1GDHA 1VLLA 1EZ4A 1I3MA 2J5QA 2JFFA 4ZQGA 1Z74A 4D43A 4MKZA 5JS6A 4XZ3A 5FYDA 3NX4A 3UCFA 4DQUA 4WLNA 3CE6A 4AVYA 3FF4A 3FBTA 4AJOA 4XCVA 1LDEA 4I9NA 1EBFA 3QSGA 2GR9A 1WLYA 2B83A 1IULA 4IDEA 5FI3A 3TN7A 1K3TA 3H9EO 1MC5A 4TRRA 1NASA 1GCUA 2DBZA 3JYNA 1SEVA 2WJPA 4ZQFA 4O59O 1SB9A 3ASUA 3GFGA 2VOEA 3AUSA 1N2SA 2IZ1A 4KMSA 4BNTA 2FHSA 3ZZNA 5FEUA 4YYZA 4DQXA 3DFUA 2ZB7A 2PGJA 4L4XA 5JNLA 5L7YA 3OM9A 5DT9A 3CINA 4PLHA 4CV1A 3M2PA 1P0FA 4L76A 5IAAA 2BD0A 2FY8A 4PRKA 3KSZO 4GX0A 1BMDA 2DUUA 3TPCA 3GRPA 2J5RA 1YJQA 4P4NA 4B3IA 2AE2A 1C1DB 4D3DA 2Y0DA 1ZFNA 2AQ8A 2O7QA 3IJRA 4B4UA 1H9BA 3LVFO 5ITVA 3DBRA 2Q99A 4ALJA 3IIEA 1P74A 3AJRA 3NJ8A 3AWDA 3K96A 4OGWA 1XSEA 3A28A 4OO3A 3ROMA 4OXKA 3RCBA 1DHTA 3UVEA 2WYUA 3L9WA 1UR5A 2GD1O 4L0QA 3RKRA 2PFGA 5CEFA 1X7HA 3O9ZA 3ZNPA 4CLHA 3NT5A 5KTKA 3R3JA 1UP6A 4YPOA 4JROA 3JQFC 1ZH8A 4TRMA 3WJ7A 3PGJA 5F5LA 1EVIA 5TSDA 3C1TA 4RVHA 3TOXA 2NQ8A 5IN5A 3KSDO 4Q3CA 2H9IA 2QYSA 4WLEA 1GCOA 3OIGA 4MVJA 4FC7A 1CDOA 4CL8A 2DM6A 3RAJA 4LVUA 1NXQA 2QZZA 4DL9A 2X5OA 2NTVA 1EFKA 3NDIA 4CQMD 1Y81A 2R2GA 1XA0A 1PJ4A 3OIDA 4LISA 4KWIA 2HU2A 4MDHA 3OETA 4K26A 3AUTA 4UEKA 1F12A 1DC5A 2OBNA 1J49A 4I5FA 3WFJA 5L3ZA 5DCYA 1WVGA 4F6CA 4FR5A 2HK9A 4ALIA 2AQIA 2NWQA 1RM5A 4QFCA 3H9UA 4IJVA 2GERA 4UVGA 1V0JA 3QWFA 1HYEA 2B5WA 4KOAA 5T57A 3AM3A 1CYDA 2HRBA 2RBEA 2WYVA 3DWFA 3PGXA 1HF3A 3ONFA 1EUCA 4PG5A 4FFOA 3ZNQA 5HWSA 2C5AA 5CDUA 3HHPA 1IZ0A 3ZWCA 1X15A 1XEAA 4EITA 1KVUA 4AJEA 4TZKA 4BNFA 5A5EA 3DC2A 2O48X 5L7TA 5KJCA 4ND5A 1NYTA 2AE1A 5EQFA 4IDDA 3PJDA 4NBTA 3OIFA 3TZ6A 4CR6A 1QG6A 1DO8A 1GUZA 4ZHSA 2OHXA 5JO0A 2DU8A 2CY0A 1PJTA 1A27A 5L4SA 1LDNA 2GPTA 2DLDA 1LBEA 2DFDA 1T2EA 4RVGA 4TKMA 5JFOA 1OZAA 4XQGA 4N5MA 5IDYA 4GLOA 2O3JA 3L0DA 1P1IA 4RF2A 1XKQA 4TKLA 4NG5A 4ZQBA 4NBVA 5C7OO 1EE2A 1WNTA 5I7VA 3FTPA 1AUPA 2FR0A 3LC7O 4TRJA 5L4LA 2J3JA 4E31A 1LSOA 1PL7A 1MP0A 3ZWPA 4B7XA 2JAHA 2VHYA 4JJIA 4GPD1 2CMDA 3IL2A 1Z7EA 5C5IA 2WEKA 3GVCA 3RKUA 1KETA 5KJFA 3UH1A 2NU7A 4O1MA 1SBYA 1O6ZA 2OORA 4X54A 1DIHA 1KVSA 1GV1A 3KYDB 4FGWA 1VSUA 3GNQA 3OF2A 1EE9A 2D0IA 1MXFA 2PK3A 1WZIA 3VPXA 4MKXA 4R4JA 1OBFO 4NK4A 5A9SA 5G0UA 4CODB 1Y7TA 1VJ0A 3R1IA 4MP6A 1UXHA 3K8ZA 3M1LA 1E7MA 4Y6RA 1XDWA 1VJTA 3CTMA 2XPCA 3IMFA 3RBVA 1KC1A 3KUXA 5TLSA 2BFAA 4P38A 2EXXA 4J1QA 1NNUA 5JAZA 4CUZA 5TX7A 3UXYA 2DBQA 3AI1A 5G4LA 2CF5A 2VNAA 3FCOA 3JQGA 3TOZA 3AW9A 3PTZA 4FS3A 5EMHA 1E3EA 1PZFA 1U7TA 1I5RA 4J1SA 3CH6A 3HE3A 2Q3EA 5GY7A 4YAEA 1XIVA 1N1EA 1IYZA 1TEHA 3C7CB 1SNYA 3MJVA 3WB9A 2HRZA 4XX0A 1WPQA 3CEAA 3DEYX 4BNLA 1LC0A 5HTOA 5LCXA 3DBLB 3UW3A 2FPIA 2G76A 2QHXA 1IHYA 2DVMA 4RPGA 4CM6A 4MOWA 2CUKA 3I5MA 2X9GA 5JDCC 4BHTA 3TJRA 1ENZA 3GHYA 2J3HA 5KOIA 1MFPA 1AGNA 3F5QA 4DYDA 5DBIA 5I7EA 1FDUA 1T2CA 1CERA 3GNSA 5JCJA 3WGYA 2WD7A 4GQAA 1DJNA 1B3BA 1MLDA 3ZWNA 1J0XO 5K6AC 4UAGA 3LF2A 3WBBA 2B4QA 4DLAA 5DDIP 2GCGA 4WCFC 4U0KA 2Q46A 4YAJA 1KERA 3I23A 3ROPA 1ZEMA 5B4VA 4JN6B 1XU9A 2EW2A 1UXIA 4HKTA 2Z5LA 3RUHA 1UDCA 4BO6A 2VN8A 2YDXA 3UCEA 4EBFA 5EPOA 3H2ZA 1PJ2A 1ISMA 4CLEA 5JY6A 3OQ1A 4ND2A 1EK6A 3S1LA 1IPFA 3UOGA 1C0LA 1ZXLA 3ZV6A 4DBVO 3D4OA 1QSGA 4OXYA 3RJ5A 4OKIA 1PL8A 1E3IA 3W6ZA 4UUPA 2ZTVA 3KLMX 4XWYA 4EI2A 1NQ5A 5U4QA 1GQYA 3F47A 3U4DA 3UN1A 3HFGA 1ZSYA 1ZW1A 3GMDA 3L6EA 3O4RA 5G4KA 3U4HA 2HO5A 2O4UX 4IDCA 4GX2A 5DOZA 4CLRB 4FCCA 4PZDA 4GX1A 2EGHA 4PIVA 2ZQZA 5U9CA 2PR2A 3AOEC 5CDTA 2HKIA 3ORFA 5H83A 3TDKA 5I7FA 1DIRA 1U4SA 5BSEA 1V3VA 4AJ2A 3PJEA 3HQ4O 4B7CA 3L4SO 3RJ9A 1T4BA 1BXGB 5JSFA 4IGEA 3DOCA 3OSUA 5A06A 1W0CA 4GBJA 1NP3A 4XYBA 2YFHA 4NFSA 4YR9A 1LSSA 1WDLA 2VWPA 3N7UA 1GZ6A 1M75A 4MIYA 4J7XA 4ZICA 3OP4A 1W8DA 4OH1A 5GZ1A 3H9QA 3ZWBA 2VWQA 1P31A 1UP4A 1X1EA 4A10A 4BGUA 4BUCA 5JYEA 3PLRA 2O2SA 4Y6SA 1ZZEA 3KV3O 3OQBA 4ND3A 1YQGA 1BXGA 3IJPA 3CPSA 3SC4A 2PKRA 5KCZA 1YL5A 3AOEA 2D5CA 4OM8A 4LMPA 3CUKA 2JAPA 4EJMA 4PG4A 4MIOA 3NUGA 3PFWO 4CMIA 3Q2KA 5H82A 4E3ZA 4CMBA 2PZKA 4J4HA 2XOXA 3DBLA 5KIAA 2J8ZA 3CZMA 1PJCA 2ZJ1A 5F1OA 1ZK4A 4P8RA 1DRVA 4BIIA 1I8TA 4YAKA 3QVWA 1U2GA 4BNUA 3PQDA 5A3VA 4AL4A 2AG5A 2B0JA 1PWXA 3U3XA 4J0FA 4CL3A 1O9BA 4YB8A 5JPIA 1Q1NA 1YRLA 3A4VA 1HZZA 4H16A 3DZGA 4IY1A 2QQ5A 4E2WA 4QEDA 5T67A 1R37A 4YDRA 4OKNA 1OFGA 1BRMA 3IUPA 4FOOA 5CDSA 4D7AA 4J4TA 4XIJA 3ZWMA 5B4TA 5JY1A 1GPJA 2EERA 3PPIA 5AXBA 5CDGA 5HRUA 4RZIA 2NUAA 2HMVA 2PZLA 1ADGA 2GO1A 3KYBA 2HMUA 5F1PA 1P3DA 4RF5A 3VVBA 1DRWA 2QX7A 1LXCA 1NHWA 4R1NA 3KYCB 3KB6A 4CM7A 5FF9A 5DBGA 1HETA 4B4OA 2I76A 3PWZA 5JAIA 2W2KB 3AUUA 1VL8A 1R6DA 3I83A 1P45A 2XF8A 1M6HA 3DXFA 3L4BC 3IOYA 4RJTA 2NQTA 4Q3BA 4IDFA 3HADA 3WIEA 3HDJA 4MO2A 5BNFA 1UP7A 1ZJYA 5T5QA 1UAYA 3GC6A 4CMIB 1U5AA 2WWRA 1A7AA 2NTJA 1DEHA 4L9RA 4A27A 2DTDA 3F9IA 1CRWG 5A1TA 1O94A 3DAPA 4A2CA 1H6AA 4M49A 3QJ5A 2X23A 4DXHA 2EV9A 3LDHA 1BW9B 5THKA 2HDHA 4RDIA 3BAZA 1NVGA 2Q1SA 9LDBA 1YL7A 4BKUA 2X6TA 5C7LO 3T7CA 2A9FA 3BHIA 3SBOA 4WOKA 1O8CA 2E82A 5HA5A 3RC7A 5JXWA 1Z7BA 2VRCA 2VQ3A 1J5PA 3OFSA 5JDCA 1LDGA 1N92A 4O6VA 5KVQA 1P44A 1VI2A 3ZU5A 2DUWA 4IMRA 1EUDA 1D1SA 2BH9A 4BNJA 4I9UA 3NDJA 4GI2A 4K28A 3DBHB 4DIOA 2Y67A 1JU9A 4WLFA 1V9LA 3GDOA 1OOEA 1VRWA 1U8XX 4IJUA 4YJGB 1MG5A 1EK5A 4ZGWA 4HFNA 4QUKA 4UREA 2HAEA 4W9NC 1EEHA 2RH8A 4W7HA 3GGGA 4JIGA 4JLWA 4GGOA 2NM0A 2YYYA 2CF6A 2AA3A 4I8XA 4J1TA 3PLNA 1I3LA 2VTDA 3WGTA 1ISHA 1S7CA 4IM7A 1X7DA 1P33A 3JYOA 3K30A 5CFZA 4PLGA 1T1SA 4E33A 3ETDA 1PZGA 3RC2A 4MP8A 1GUYA 1B8VA 3VKVA 5IN4A 4KDEA 3ZU3A 3P7MA 3BZUA 4YBZA 2OOSA 1I2BA 2D8AA 2WMDA 1SCUA 1DFIA 1HDZA 2I99A 3CMMA 5ICMA 5L40A 3LQFA 3WLFA 1ML3A 1WMBA 2V7PA 3H6KA 4BL5A 5FWNA 1YJ8A 3JQ9C 1QYXA 1XQ1A 1WAMA 1HDYA 5FI5A 3PIDA 1VKNA 4Z3DA 5B1YA 3M1AA 2HJRA 2UAGA 2YJZA 1NFFA 4K1LA 4IS2A 1I36A 3BTVA 3HDYA 2W2LA 4RLHA 2HQ1A 1N7GA 2NVBA 4IPTA 1HDGO 3D1LA 1C14A 1HE4A 1C0KA 1XG5A 4AJNA 4CM4B 5DP1A 2Q1UA 1U3UA 5AVOA 3S55A 3DQPA 4JCOA 1PJSA 2POQX 3PZRA 5EESA 4HBGA 3PHGA 4IDAA 2QRLA 1T1RA 4GMGA 1AN9A 1EDZA 3F4LA 3DHEA 4BNNA 1QORA 3ZH2A 2GSDA 3NJ4A 2NACA 1LLDA 5CG1A 1D4FA 3PRJA 2OP1A 4NDNE 2GDZA 3GUCA 1ZCJA 4FJ2A 2C2YA 1XR3A 1LQTA 1MUUA 2X5KO 1HLPA 2P9CA 2WD7B 2X22A 2VHZA 4Q39A 5ICSA 3DMYA 1V35A 5DZSA 4IS3A 4CMAA 4JBGA 5LDGA 1ZK1A 5I7SA 1E3JA 3AFNA 1ZMTA 4MJLA 3JYQA 1R15A 3STHA 3DB2A 3DMTC 3MJ4A 4E12A 4XQEA 1E7WA 3C7AA 4XQCA 1YONA 2BHLA 3DAGA 3NEPX 4MINA 2PKQP 3ST7A 3U49A 1Y5RA 3WICA 4E5NA 4I1IA 4AJLA 3GG2A 2FZWA 3C85A 1WP4A 1R66A 4LSWA 4U6SA 3L9XA 5J23A 3N74A 3JQ9A 2PY6A 1RYDA 4OMUA 1EUZA 1NR1A 3FNFA 5JCJD 1I24A 1XGKA 4XYLA 1ZIDA 1PGJA 1VE9A 1CETA 5JO9A 5AXDA 1CF2O 3QV1A 1YO6A 4L4RA 4TRNA 3VPFA 4ONEA 4PLTA 1ZSNA 2O3RA 4N54A 2GRAA 4WNIA 4XKJA 1BDBA 4YAGA 1UZLA 1XLTA 5TRTA 2BF7A 2I3AA 1YQDA 4TZTA 5HS4A 3SJ7A 4CPDA 3INGA 3SEFA 3TZKA 1Y9EA 4Q3NA 2YV2A 3GT0A 2VHWA 4PLCA 3LZ6A 1ONPA 3OJ0A 4Y8VA 3FWZA 3TSCA 1GADO 1Y8RB 3AY6A 1DPGA 3GAZA 2UUOA 3ZHZA 1XYGA 1D1TA 1YBVA 4AJJA 3IAHA 2V65A 1L1FA 3E6AA 2ZK7A 4LVCA 4NBRA 5C7IO 4NJMB 5IJZA 2CVQA 1KVTA 3ZWWA 1DIAA 2H63A 3LT1A 3EDMA 4CV3A 3RQSA 4WCDA 5TIIA 2CDBA 2BMAA 3JQ6A 3HWRA 4BOYA 3H3JA 4GH5A 4LW8A 1K6XA 4CM4A 1B3RA 1LU9A 4XQ9A 1U2DA 3W6UA 3WGOA 3GPIA 2A35A 1W73A 4JBIA 3FR8A 4WLUA 1H94A 3GR6A 4NBUA 1JWBB 4CM5A 5COAA 2C7GA 1V6AA 4NZ9A 1T2FA 1JLLA 1JKJA 1DDOA 4WGGA 4Z6KA 3H9JA 2GASA 4WKGA 4XDZA 5ER6A 2W98A 2SCUA 5IZCC 1RWBA 1Q7BA 4KQXA 4QXMA 5L45A 4AJ1A 1HKUA 4PG7A 4R3NA 3GEMA 4J43A 3PJFA 1ZUD1 3PYLA 4TROA 4D41A 2FRDA 4UULA 4GWGA 4YXFA 3X2EA 2WD8A 2B36A 1P1RA 2G1UA 2O3UA 3MJCA 3MWDB 5TGDA 4Y9DA 3E5MA 3JV7A 3QIVA 3KVOA 3IQDB 4J16A 3ZWYA 4IIUA 2VOJA 4RQTA 5COQA 1GZ3A 3RUIA 3OA0A 5FFFA 3L6DA 5DULA 4AJ4A 1ISGA 1HE3A 3BMCB 1V3TA 4JP2A 1RPNA 2J5KA 3IS3A 5JBIA 2IODA 5CG2A 4LK3A 4YACA 4B79A 3TZCA 3I6IA 4I9HA 4YJGA 3ZV3A 4XIYA 4A0SA 3PJGA 1PS9A 2O23A 4YJFA 1BDMA 1G0NA 4FC6A 4NU5A 1Y5MA 2VT2A 4Y67A 1EVZA 1XHLA 4DPLA 2VT3A 4YWJA 1OAAA 4PVDA 4NFHA 4XR4A 1X13A 2ZKLA 1PQWA 2ZATA 3E9MA 3KYCA 4U6QA 4PLFA 1LDMA 2ILTA 4B4VA 4NJMA 3MZ0A 4WCFA 1RYEA 3ON5A 2X0JA 1E92A 3MJSA 3KTDA 1TVEA 4WECA 5A3JA 2HSDA 4KZPA 3ZU2A 1X0XA 1QYCA 1LLCA 3GK3A 1BW9A 3WQRA 1XCBA 3HG7A 2HUNA 1ISJA 5EN4A 2VYND 1R0LA 1HDOA 3WDSA 4KTTE 1F06A 5B37A 5A9TA 4D46A 4WPGA 3DHNA 4PRLA 3KXDA 4U0JA 2AQHA 3ETEA 3LLVA 1HT0A 4FB5A 1TT5A 2YQ4A 1TB4A 1ORRA 3JSAA 1C1XB 4M54A 3ZWAA 2B69A 3PYXA 1YL6A 2DFVA 4RF4A 5JE8A 4DRYA
chains in the Genus database with same CATH superfamily
3IALA 2HO4A 1WCIA 4ZEWA 4AY2A 3JQQA 1ZINA 1Y5LA 1SVNA 3KELA 5MGBA 3IHKA 3EC2A 3RKSA 3WIUA 4F4JA 3PD0A 4B6PA 2FPIB 3ZZTA 1YDGA 1ZN9A 2C04A 1CB0A 3ETJA 4OSEA 3EXHC 3STTA 3R9XB 2ODBA 3H2BA 4TVOA 5LQNA 3E5NA 1ZKMA 3RVBA 2AMFA 2DYKA 1GZUA 1KIFA 1O94D 1Z6PA 1WY7A 2N42A 1VYHA 3WK6A 1T9AA 3HXPA 3AVTA 1U28C 3G1TA 5A2QA 3GMSA 4DBZA 1E98A 1SQ6A 1S9HA 4G09A 2ZAMA 4CMJA 4ZODA 1DKUA 3QUTA 3FNEA 1E1RD 5J4LA 4F9FA 1W1UA 2B82A 4Q9KA 5DP2A 2GBLA 1XP8A 3D3WA 4D82A 5ERGB 3RIXA 1V8ZA 3WK9A 3BCSA 3PWKA 4OPMA 2WB2A 4MI1A 3MCZA 1SAYA 1Z0IA 1ST3A 1TF2A 3BMNB 3FE2A 1UH5A 4DS3A 4BJ3A 2OZVA 3LWZA 4DV4B 1GR0A 1IJFA 3UO8B 2XCLA 2CLMB 3TMKA 4L2IB 4Q1AA 4JQYA 1WPXA 4OYYA 4LBVA 4BLRA 4BMSA 4YJFB 3TR5A 1XVTA 5KYWA 3DKIA 2YS6A 4G0YA 4TLBA 1Q1BA 2R1UA 5EJMA 4GP7A 4GVXA 2AWNA 3QHAA 5J58A 4FW9A 3IDSA 1HT3A 2FQYA 1WMDA 1EFTA 3AO0B 2Z6UA 1RRPA 5EIHA 4RYDA 1D1PA 2YHAA 3NIGB 4AZTA 1OI4A 3LLSA 4E5MA 5IAEA 3KVYA 3AB3A 4Y2XA 3ZDZB 4PAWA 2P9YA 3UAZA 3DC7A 3TX6A 2WLSA 1NOIA 4BCDA 4DLBA 3JU3A 1JL3A 3FZQA 4K3UA 4A73A 4LFCB 4FFWA 3BIFA 1QTRA 2RJ3A 3EB9A 5CVVA 1TM1E 3A9WA 5SYNA 4CGYA 5JI3E 2IYNA 1ZVVA 5KQSA 1TUEA 4XAQA 2PJUA 2OB2A 5DGXA 3VDRA 1V8FA 2HY7A 4LQDA 2A3NA 4B3BA 1SUCA 4FDVA 4QBGB 2VHQA 5K3OA 1E7YA 3UAXA 2OP0A 1TIBA 3I4FA 4N7RA 4EB8A 2YWGA 3UHAA 1HOXA 2IDMA 2W48A 4W1QA 1OC4A 2I9PA 3AFGA 2JD2A 3BJEA 1YBHA 4OG2A 3EOBI 1Z0DA 3PU6A 2I2FA 3UAWA 2LIPA 3RLFA 2REOA 3UWKA 3QE4A 2CVPA 4YA6A 1W5FA 2QSZA 1SHZA 2CYAA 2V0CA 2WU4A 2ZCVA 3BGIA 4IYJA 4B2LA 4DTCA 4EYEA 1I7SB 3WGIA 3JW8A 3TTUA 2G6BA 1SQSA 2ACVA 4CR7A 4QYIB 4OX9Y 2P8SA 1RNLA 3FNBA 2PRYA 4YDHB 2DWQA 1NSTA 3MFYA 4MITA 3S8MA 5I7UA 2FKNA 3EWAA 3GRCA 3D0KA 3I5UA 1OXVA 3A9SA 1PG5A 4I50A 1ECJA 2X41A 3VH1A 2BSAA 1UM8A 1WHTA 3ND9A 5GJBA 5JZMA 4Y6GB 5MGNA 2X86A 5KKCA 2BI7A 1NF3A 3O21A 3S7ZA 4TV9B 4GQIA 2PU7A 5KI6A 3C1AA 1RAEA 3ABQB 4L8YA 1A2QA 4PR3A 2Z5VA 3ZKAA 3HKCB 1HM5A 3JD2A 1OI2A 4GMFA 3HXOA 2DR3A 3TFOA 4K9SA 1NZDA 3W77A 4AO8A 4CIWA 1F6WA 5EJ5A 1Z5OA 2HDWA 2B35A 3I9NA 3IV9A 4M9UA 4XUDA 5TR9A 1S5PA 4ABYA 2Z2JA 4BEVA 3D6JA 1H2AS 2PUWA 1QH1A 4GXTA 4EFKA 3DMRA 1JZQA 4X95A 5I7RA 3ZJUA 4RL4A 3R0JA 1F0KA 5A0FA 1MU0A 3AJDA 4GPIB 1QPZA 2DBRA 5DYIA 3WA6A 3RW9A 4R68A 3N5KA 2DEUA 2B4RO 3VZSA 2XD9A 4ZOQI 1DX4A 1EX6A 4V0NA 2A86A 4ND1A 4MSUA 4D98A 2Q3LA 1IDN1 2FEPA 2XD4A 1PT6A 4Q00A 4P9NA 3ZN2A 1BWSA 3C5HA 1Z4IA 5C8YB 2J9ZB 3PCXA 1JSLA 4RF3A 4ENPA 4AURA 1MZPA 4L7QA 1QGOA 4WSOA 5ARCA 1RLTA 1CKEA 2OGUA 2J08A 1BX3A 1N6HA 1Q0PA 4TV8A 4HOYA 3RFFA 1EGHA 3ESCA 1OROA 2PRIA 4PG6A 3LQYA 4MRNA 1AC5A 4EG6A 1CJUC 2WWFA 3RV3A 4FZ3A 3SYRA 4FBGA 1GKUB 3JQCA 4RD0A 5G0WA 4ZWNA 5EJ7A 3VKHA 1HV8A 1YE3A 3BILA 3Q9SA 3LFHA 1NYQA 4IDOA 3DL2A 3BCRA 5HE9A 5C35A 1OT5A 5CXQA 1JJ7A 4MEJA 2HRRA 3EZNA 3SKVA 3W4JA 5DRYA 1HSZA 3V42A 2C3MA 4AD8A 2PGLA 1PCXA 1E2KA 2ZBGA 4NENA 1V8PA 4RCZA 4DMKA 4WKPA 1I32A 2Q6LA 5ALNA 4WBNB 1PJ8A 1JVNA 1THZA 1GAQA 1NFRA 1QYVA 1PDVA 3AUAA 3EG9B 3SD7A 5CCEA 4FFLA 4Q93A 2BGWA 1JAYA 2CNLA 1GTMA 2ZVDA 5G3ZA 1N57A 5JWOA 5KS2A 5FV7A 1U3WA 3U40A 1GVNB 4DXDA 2LCQA 4X64B 1OH5A 1AQUA 2AFVA 3IFSA 4YRBA 4K9QA 4F9TA 4N5NA 1JS1X 2O5VA 4L1KA 1M54A 3IAUA 1TJ5A 4JBHA 2PLNA 4IOJA 3DLTA 4J7AA 3OPQA 3CZQA 4AX4A 4WCFB 4KFTA 4MPTA 3ASVA 1AN0A 1CW2B 1UDAA 4TTQA 5KQPA 3HSKA 3P20A 5GZ6A 3W5JA 2UUCB 4B45A 3DEKA 4AXBA 4CQNA 3LUAA 5D6OA 1B0AA 1ZUNB 5KTTA 3K2IA 3C6QA 3LJKA 1A8HA 2ERXA 4HNHA 5EY5B 4PC3A 1BA2A 1ZCAA 3F78A 5JD6A 3T9AA 1A72A 1XCMA 1RHRA 3D9QX 3AVPA 4R8LA 4XYEA 3QRWA 3QVGA 3R75A 2XA9A 4CUJA 3D6HA 2Q0QA 4NAVA 3KK0A 3KWJA 4UDOA 5AT1A 3O3CA 1IB0A 4E21A 2H92A 1JFSA 4IHAA 1LS6A 2QUAA 5ALRA 2AMJA 4AY5A 4MHTA 2JGLA 4J7CA 2FPXA 4OL9A 1UK8A 5DW0A 1UJMA 3ZDEA 5JEEA 4U7WA 3UG6A 5I4CA 5CIYA 1TM5E 1GV0A 2A6PA 2PWZA 4B83A 1E5TA 3LCRA 2IPXA 4QLBA 1VRCA 4HP8A 2AOTA 1GG9A 4FEEA 3GUUA 4MJ3A 2JEOA 4X85A 1UJNA 3LT4A 1GZ4A 4BMZA 5CPFA 2P9FA 4WLVA 3U4CA 4II3A 4RAQA 3HUTA 1RKXA 2WTEA 3GRKA 4PHTA 2KPOA 2IXAA 4IQFA 2BHNA 3C8DA 2WUEA 2GCIA 5EFOA 4CN8A 1Z56C 3DMNA 3RU9A 3ELUA 4AAYA 3NHJA 1UPTA 1XNHA 4B6EA 5JW6A 4P4TA 2H5JA 1AKTA 1J2JA 1GGKA 1BXRB 3HY6A 3NTUA 4HH0A 5M3BA 4N5IX 1ZAYA 2NSYA 3GJ4A 1W581 5ELLA 2BEJA 1V5EA 4GOND 4Y9SA 2PGDA 3P27A 3DPSA 4NAHA 5F7ZA 3IRUA 1T0BA 3SF8A 2P4HX 3NWOA 4PY2A 2BZSA 2DCUA 1B8UA 2AWOA 2IU0A 1L4LA 1VCMA 4UEQA 2WWVD 1RACA 3SXJA 3UEOA 2CLDX 1CHNA 1Q14A 3ML1A 4KKVA 1C4KA 4OYRA 4WXYB 3AY3A 5AXCA 2JVKA 3LPNA 1NI3A 4EG4A 2OCLA 4A9AA 2DJ5A 2SNIE 4LF7B 1PQYA 1PDWA 1ODLA 2BZGA 3QOFA 1H42A 3HY3A 4J9VA 3OTOB 4Y1EA 1HNZB 3UFXA 3PEYA 2XCSB 3ZKWA 2D2IA 4UE2A 1X1SA 1TTTA 4YRMA 4Q9JA 2IFTA 4TT8A 2WWIA 5E9AA 1ZY2A 2RAFA 5IJ0A 4BBAA 3BQ9A 4G9BA 1QDUA 9GPBA 3W2EA 2WSIA 5LQDA 5DSTA 4ZV7A 2W2VA 4G67A 4AJKA 4EUHA 1RIIA 3V2HA 1ZONA 1QRUA 3FLEA 5CFOA 3UB2A 1NNI1 1W29A 2VZEA 3AT1A 2HMYB 1O6GA 4B3HA 5ITWA 1PL6A 3H4IA 3P2OA 4JS0A 5A4JA 1FRQA 2HDNB 1L1EA 3HCRA 2H4ZA 4OQQA 5FBZA 4N7MA 4DA9A 1JHXA 1XCJA 1B15A 4MTLA 2ODWA 4XFDA 3DTNA 4FYMA 2PQ0A 4M9QA 2ZU0C 2GXSA 1ADCA 1XLUA 4WOBA 4NOKA 2N9UA 5E0OA 5JANA 4B3RB 4HAZA 1W96A 1JSRA 1Z62A 3ORSA 3BDAA 4NV1A 2C1XA 2R1VB 3Q0TA 2C4VA 3EISA 4NCJA 1IBMB 2YZGA 1E9FA 3BDIA 4NQRA 2DC1A 5DXAA 3DCIA 4MWGA 4WZAB 3ZW9A 1Q1EA 2NV2B 1YUMA 5EPUA 5HIJA 4DA7A 1PR0A 4J29A 4HY3A 3R5SA 1RI2A 2JIBA 3RIEA 3UA3A 4HB0A 1RRGA 3KQOA 4EGSA 6PFKA 3UNXA 1KTVA 1EFDN 4MK4A 3Q9UA 3B1KA 4I1VA 4I1OA 3KP1A 4NIMA 1R0ZA 4DSOA 4UFOA 3OOWA 1LDBA 3N2IA 2A67A 4M2LA 4EDFA 4UTRA 4UBIA 4ZQHA 1QCZA 2R6JA 1E2JA 1RW4A 1GG5A 2VQFB 1Z68A 1H9CA 1O96A 3ZYCA 3NORA 8GPBA 1Q57A 4FOSA 1CUBA 1M8FA 1QVAA 3LC0A 4YK7A 3KETA 2HLNA 1SVUA 1JVSA 3ITDA 2V54A 2IHTA 4MO9A 5ILQA 4BFVA 4ZCPA 5KJEA 2QJFA 2EP7A 3PNPA 4ODIA 5KSWB 3THWB 4M3NA 2EQBA 4EHAA 2C7PA 4ZKEA 4LQLA 2X5XA 1VHWA 1L5VA 3IPYA 2JJ8A 2C8KA 3I53A 3RYIB 3DT9A 3PWSA 2B99A 2CNWA 4HL6A 4F11A 1EYZA 1UXJA 2H1CA 2V3VA 5LZ7A 2JBAA 2RK4A 1MX9A 4ZOLB 5LMZA 1DZ3A 1VL1A 2C2ZA 3L7LA 1L4KA 1QNFA 3MTDA 2XMCA 4LHEA 3R9IA 3RJZA 1JTVA 3LPAA 3K15A 4ZU1X 4OGFA 2C59A 4A23A 2EF1A 1R6UA 1E2PA 1RWVA 2FWPA 3AM5A 3G0GA 3GRUA 4PLPA 2HA3A 1RKQA 2QAGB 4RVFA 4F86A 4RABA 2O5CA 1A4XA 3OMLA 3OJLA 3JTEA 4DZTA 1OB5A 5JQGA 2YZMA 3VVCA 2ATVA 5K8JB 4BEBA 1SMKA 1U0JA 1X9IA 1ZGZA 3AU9A 5HBRA 3JZMA 1JDBC 1IY8A 3FIJA 4OATA 1OBOA 1XK7A 2IEZA 3IEUA 4D3FA 1Y1TA 3AYZB 2GXAA 1IVNA 2JGDA 1AE1A 5BUQA 2CDAA 1KFJB 4LZLA 5LWQA 4GLBA 3OQ6A 5DTMA 4L8LA 4FLFA 3CPHA 1E2IA 3OEEA 3IAFA 2O50A 3EULA 3K1AB 1R8XA 2MSWA 4N5DA 4UMDA 1V1RB 3D6UA 1Y33E 2CXQA 3VR1A 3T7SA 1L3IA 1NX6A 3TQRA 4BKRA 4MUEA 5BN3A 4QC2A 1V43A 5DYNA 1ONNA 1RVV1 2HV8A 1U81A 1F2DA 1GQQA 1P1HA 4NEQA 5EXSA 3RTAA 2G9ZA 3AG6A 4CEIB 3HZZA 5JVDB 1HYHA 2WABA 1T8TA 2OK7A 2R8PA 3F3KA 1KQNA 1C0IA 2JGJA 3TIIA 4AY3A 4I1SA 5LZ9A 4M9XA 4O2AA 4N40A 4LY9A 5EIAA 3GEGA 5TT0A 4BLQA 4O4IF 5FUQA 4PNHA 3HR8A 2WF7A 4X7RA 3K0FA 1W4CA 2EBHX 2VHUA 3AI7A 1SWWA 3RFTA 1DCFA 1GO2A 4KYVA 3SLRA 4OVKA 2W70A 3M6WA 2JD1A 4MVJP 4G5GA 1QH0A 4MMYB 5HUHA 2IP4A 4KMOA 5K6AA 1NJ8A 1H2BA 2QNBA 1IOVA 3NNNA 5EKDA 4X7PA 1SD5A 3TVTA 3L43A 3MGGA 1EDBA 2F8LA 1HT1E 2WDPA 3WGUA 4AKGA 4FHDA 2HLDD 4MRAA 3B7WA 4RWEA 3VOSA 4A1OA 5H59A 1TNDA 1DJMA 1FYFA 3ZVKA 3PXGA 4G4GA 2Z8YM 3FPCA 4YDQA 3SJCA 3R20A 3O3NB 4DUYB 2HSGA 5CT5A 4EKIA 5JCXA 2WKWA 1DAFA 3KEMA 3H1FA 3PHIA 4M89A 4MV3A 4EZBA 1GRVA 3LL4A 2OWEA 4RJLA 2GN9A 4I2NA 3OD1A 3HYRA 3UKDA 1RI5A 4HDOB 5KJ1A 1XNGA 3HC7A 1WVMA 3P9NA 3N0TA 3W04A 3BS4A 3MCTA 1K7SN 3QPVA 1GPMA 2ZAOA 5ALOA 2OQVA 3GLGA 1FP7A 4KYIB 1YKSA 1TK3A 1YC5A 2IHNA 2WG0A 4DCSA 5KMGA 3DCNA 5IYZA 4MW5A 2UYHA 1QIJA 4WZBE 5GJWC 4MWOA 3HKBB 1NBEA 1IMOA 3K73O 4LF8B 3ZW7A 5G3YA 3G7NA 1YIAA 4GMXA 3ZGNA 5DM60 1XRMA 2DLCX 4AROA 2O2CA 1OU0A 2EW1A 3L8EA 3M9WA 2WAMA 3BEDA 3EBOA 2I4IA 4LHZA 1BVYF 3M6MD 4YY3B 5BVGB 4XW2A 3UGJA 5K9ZA 5A71A 4R8RA 3BX1A 5FLYA 5C1BA 1JEYA 1DEXA 4AUEA 2MMGA 3CUWA 3RYFB 4EF6A 2PAFA 4IIJA 1QCYA 2NSDA 4TYPA 3R24A 5ALUA 1E77A 3FUWA 3UB4A 2X4IA 3KV1A 4D0NA 2H18A 1E0DA 4B9EA 4RV9A 3QLJA 5JZVA 3PFHA 4BO2A 4WTOA 4B5KA 1MC8A 4XVHA 3GNTA 2AR9A 4E08A 4DY4A 4O3MA 2YYSA 3B36A 2YYAA 2XVMA 1DKQA 5U1PA 3L1VA 5EJ2A 3ZY2A 3JD4A 3TD9A 2EZTA 3P9IA 3G2NA 3PKZA 3GZNB 2QRVB 4FDMA 1MO3A 4Q82A 1WP9A 1BXZA 4WMLA 5FOQA 4EI8A 1DT5A 3NAGA 3A4NA 1AUQA 1RVDA 2BHRA 3S2EA 4IQ0A 2Q6VA 1TC1A 2Z8YA 4N3CA 4Z7NB 5DU2A 4I6GA 3RRJA 2FZEA 5B7NA 5JASA 1PV4A 1PW7A 3G9ZA 2WWXA 1P91A 3EGWA 1XLTC 3Q3CA 1PP4A 3F90A 4YRAA 4C6RA 4XGKA 1EGMB 4BNYA 3MFQA 3DTVB 2J09A 2JIZD 1JAHA 3DEHA 4FDTA 1LLFA 3EA0A 1R6TA 5IJAA 5IZ4A 5A5GA 1SD2A 1I33A 1XMQB 1DMRA 3U60B 1N33B 3RC3A 1JALA 2PZGA 2F00A 3OKPA 2B8WA 2QGNA 3JQGB 4OY3A 5IKOA 2XCTB 3AR2A 3GPCA 4JLMA 2QN2A 1LTHR 3KFVA 4LJ4A 1L5GB 4F7WA 1PFKA 4FOLA 3I28A 3RS7A 2BLNA 1DLJA 3QY9A 2PZFA 3CLUD 4M0LA 2QAIA 1OBVA 1UC4B 1QO0A 4DNPA 3EY9A 2O6HA 1U8FO 1F17A 3CZRA 2A88A 3LHFA 3OU2A 1YZFA 4NDAA 5DN6D 5KYWB 2C2MA 4GS5A 4R16A 4FGKA 4FNOA 2IY9A 3HS3A 1W35A 4WBSA 3ESRA 4RPLA 1M1NB 4QREA 3DOUA 2GZ2A 2IEIA 2W4QA 4S1OA 4ZALA 4UTNA 2AW3A 2JLRA 1DBPA 3NUZA 1ZN2A 2I8CA 1J56A 4JI5B 1D9ZA 1ZDMA 3CYFA 3ONEA 3WP1B 5LR6A 2IX3A 4D5GA 3RC1A 1WL8A 1O0SA 3OURA 2CB9A 3PNQA 5BRNA 1KE2A 3P0RA 3VOBA 3ZGXA 5BYBA 3C3KA 4FILA 1TM2A 4KIFA 3CO0S 3TSZA 1NMXA 5AICA 1OTXA 3D6MA 3G2LA 2C84A 3QF4A 1UBHS 1VE7A 2OO7A 4IH4A 5T8KA 1UBKS 3L0CA 1L5HA 3WHPA 3T5AA 4M1SA 1PBTA 1M76A 2OCGA 3CSSA 5HKBA 3K05A 1A9ZA 4BNXA 1AY0A 1E2LA 1FTQA 1VKHA 4MNTA 2XMRA 4M8NE 3SJUA 2BKEA 1XJWA 3EZFA 4I5DA 3ZNOA 5C2JB 5C31A 4KSCA 2HA2A 4U2GA 1VL6A 5A02A 3DR5A 2OYRA 1ES9A 2O2IA 5FTWA 3CIFA 4EO9A 3ZHBA 1WVIA 2Z5FA 2V5VA 3T7EA 4BO3A 4C03A 1UBTS 5L4NA 2E0IA 4UNRA 2HCTA 2R00C 3Q10A 3DDZX 5FBQB 2HQRA 1TQ4A 2IXGA 3OQHA 4HDNB 4PZYA 5E6SA 4M7RA 1EVYA 1AURA 3I0MA 2N1MA 5J4KA 1E2BA 1ENOA 4XTCS 1SHTX 4YUVA 2VUIB 3PNLA 3R0ZA 2LPMA 3W5VA 1JDSA 1XXHA 3A4TA 1PQUA 4A8HA 1MOZA 3TM4A 1JMVA 2EFCB 3OEWA 4R05A 3VR3D 2UYCA 2XCQA 1L8OA 3DE1X 4DLNA 2P77A 1G2PA 2A5GA 1U8CB 5IVPA 1DIGA 4MTCA 5EQDA 1W88A 1YBFA 2FYTA 3IBSA 4JBNA 3GJRA 1W85B 3VHRA 2JBWA 4F4HA 4H77A 1PK9A 1U2ZA 3TNDA 1V3UA 3COWA 4RPCA 1F14A 1DXQA 2VJKA 4YHHB 1KH2A 4MVYA 3BE6A 3RT7A 1XMPA 2VSXA 4BVJA 3L7MA 3QKIA 2ZT8A 1SUPA 1OHHD 1ZOPA 4Z0PA 1XNQB 1XPRA 5C9ZA 1YJ5A 2QM8A 4N0QA 2OGZA 1JEDA 3BBLA 4L16A 4M8KA 5DYWA 3SHFA 4E4YA 5IHPA 2BR3A 3A2NA 2QQEA 3FI0A 1Z6AA 3H8VA 3OWOA 4Y1RA 3W4KA 2FPSA 1MTZA 1QGED 4H4DA 4C7OA 1OJLA 1A95A 2DHEA 3NATA 1BG6A 2GJKA 4KIUA 1H0SA 1GYPA 2WYHA 1VL0A 4EUKA 3DFKA 1LPOA 3PC4A 2I80A 2SKDA 3WGQA 3UOWA 1N6KA 1GL3A 4KQHA 1KBZA 5EA2A 3AYXB 1RWNA 3DLIA 3G1UA 1M8PA 5LDDC 3KPYA 2NYAA 3TCKA 3ZD9A 3DHVA 4Q4AA 5CDYA 3KPUA 5CB4F 3OTWA 2CFCA 2XGSA 1I0IA 4ER0A 1U3TA 4PXYA 2J9FB 1P7WA 1XA4A 4D79A 1L7DA 2IC5A 3TDNA 1OY1A 3NGMA 2FN3A 3D64A 1H5NA 2Z9BA 3DEFA 3LTEA 4RA6A 5DCWA 1E5QA 1G17A 2SCUB 5LOVB 3B3QA 4HXYA 3NDRA 3RLIA 4PSUA 1JU4A 3FBWA 4GG1A 1AIPA 5B2EA 5B57C 1O77A 1HEUA 4W5HA 4QPJC 1DBQA 2OD9A 1FZTA 1P4GA 2IXTA 4Z0NA 3K32A 3FJOA 1SVIA 4A0HA 1E4EA 1PD0A 1PT5A 2DB3A 1A0OA 1JF8A 2R97A 3HDHA 1EVKA 2ON6A 2HWYA 4GMDA 3GLKA 1T2UA 3Q7TA 5CNIA 4CIAA 1TD9A 5AKIA 5AIBA 1LWOA 4D8TA 1K8QA 4LTMA 3ELWA 4M86A 5C34B 3E9CA 3P5SA 4I81A 4H59A 5CT6A 2IW3A 3PIRA 3WGHA 4UEJA 5AJTA 1TKBA 4EABA 2WT4A 4FFRA 4GP6A 4MRMB 4TQAA 2BL4A 3U4GA 2PXCA 3KUDA 4C6HA 4CLDA 4UTPA 2VYQA 3A3NA 2QV7A 3E4DA 4MQEB 3ND8A 3PVZA 3VHQA 5K8IA 3RVMA 3A1FA 1LLQA 1RQPA 4PW0A 3DTYA 2XXJA 4QUDA 3PFIA 3B1WA 1JAXA 1YBMA 3F8TA 1F0NA 3PI7A 3MJFA 1YF3A 3QU7A 2JFGA 3BFPA 3GGSA 1N6OA 2QT9A 4QJ5A 3RYCB 3ZIDA 1I1QB 2WJIA 5I47A 1GL9B 2XDQB 3E81A 5AJZA 1L7XA 5IULC 3TL3A 2Q07A 1S02A 3LBIA 5FOSA 1U3DA 1VG1A 1W1WA 2ZIAA 1FS5A 3ZBTA 4R40A 4US0R 5KYGA 3KZCA 4NYJQ 1PV1A 2XA1A 3E1KA 3LPCA 3NBKA 4P2GA 4XD7D 4RMNA 2UZ1A 1S9DA 2D1YA 2ZT5A 4GYKA 4ZA2A 2XMQA 1VBNA 3EOAI 1FFDA 1YAHA 4P81A 5L3SA 2DY1A 1TZCA 4P80A 3HN7A 1A5BB 2VP0A 4V3CA 3GPDG 4AWXA 2OENG 2VJDA 4H18A 4TL8A 4BEJA 2JLAA 3T5DA 4CMHA 1DAEA 1MC1A 3CJTA 3SC2A 4DQ0A 4N48A 2EFYA 1FMCA 1CY0A 1XRLA 4UVEA 3BGOS 5IBRA 2UZ1B 3ZQUA 1KU6A 4AF6A 4EB6A 1J1IA 5CYPA 3VPGA 5F7JA 5C5EA 4CEHA 2DPMA 2J3IA 2IUSA 1MG0A 2QE7D 2GAIA 2JEZA 5EZYA 1Z16A 1Q74A 4M55A 1E3QA 5LNK6 1D7AA 1JDUA 4IZIA 5F64A 3H97A 2O4CA 2JIQA 3VU0A 4HGPA 3M5WA 4Y6LA 4L5YA 4EGCB 4R2JA 3PXUA 4IP0A 4QRIA 5KHLB 1WRBA 2FPLA 2JLWA 1DIOB 5CB0A 5B58T 3T1VA 4MR9A 1NI5A 1CEEA 2F9MA 4WX2B 3EK2A 5AWFC 4Z4HA 1BYUA 4WDRA 3RUDA 2ETXA 2NXNA 2AOUB 1E94E 4DCVA 2Q1TA 2W90A 3MTBA 4YT5A 4OUKX 2JFBA 1VPEA 4J0DA 4BB9A 3GO4A 1G3QA 1YB6A 2CCKA 3A4MA 3BFJA 3FCXA 3L18A 4UKDA 1PTKA 5KYUA 4PYJA 2C7VA 4FSHA 5C1IA 3T7AA 2QF7A 5JWRA 5LSAA 5CVDA 1K6MA 5TMBA 4KN9S 2CE2X 3UJAA 2BELA 3FVWA 1E2GA 3IDZA 4JELA 3U6KA 1LRLA 2HHHB 1YBAA 5KWSA 3C3BA 4YRDA 4BTVA 4XTRA 3T1HB 1EAMA 5LB2A 1Z4OA 2OXIA 5HUJA 2H57A 2O3SA 4HHEA 4AS3A 3SQXA 2HRQA 1VIAA 3GELA 1USVA 3RIMA 5FHQA 3GPBA 2ZQ5A 1QDEA 4FMDB 5KVSA 2NSJA 5HCNA 1P17A 4MA0A 4BB5A 1Y8CA 2QVGA 3PGKA 5JEDA 4L74A 4HAOA 2EP5A 1TYEB 2G3YA 3FPHA 4Q9IA 1PNTA 4ZEOA 3VZPA 4EPRA 2FOIA 4OUDA 5THQA 4DDTA 1GDDA 3OH8A 1YTUA 2QNRA 4LWZA 4H08A 2C98A 4TMKA 4UBNA 3RGWS 1GPDG 5I8WA 3N8NA 1V3QE 3E3NA 1HE1C 1TE2A 4RESA 2JAUA 4GOJA 3B5EA 3NHSA 3LOQA 1Z0JA 2R6ZA 4ALNA 3V4SA 2PV0A 3AERB 4PX9A 2O2EA 1KSGA 2JFZA 2R6CA 1Q1GA 3ROZA 1ZI6A 4OOEA 1YKFA 4PZUA 2XF2A 4EPTA 1F2VA 1DKRA 3RU7A 3HKEA 2GM4A 5GJCA 3IOCA 5C3UA 1J09A 3T34A 1Z35A 4BAZA 1TQ6A 4MYUA 3DDWA 4DM3A 1IY9A 4W1SA 4AS1A 1NHGA 2O2JA 4HLDA 1A50B 4RHYA 4I08A 1NMEA 1T5DX 1UDXA 1B74A 3LYLA 1HEIA 4ZCQA 1R0SA 3QBDA 2AFIB 1TCVA 1WY5A 1G5HA 4E32A 3TQIA 2PX5A 4EW6A 3I9KA 2OA0A 3ZV5A 4UBJA 4MKRA 2MCFA 3QJGA 1IWPB 1XXHE 2MSCB 4GGPA 1HWYA 1OAOC 2C61A 5BNTA 5K4GA 4QTTB 3ZGYA 5THXA 3T35A 3L0PA 1R4MA 2CE7A 4ZMBA 1XU7A 1ZIXA 4F9EA 1L6IA 2OEPA 1P0IA 2Y99A 3ZK9A 2AG1A 3VZRA 2O57A 1F7VA 1NY6A 1Q1QA 4Y2VA 1P4AA 2W2XA 3MXTA 1TCUA 3MT9A 4TWIA 2ZBPA 4WAUA 1PNRA 3L93A 2QPOA 5JJ5A 4U2BA 1UANA 1GGVA 3ZHTA 4N01A 1E32A 1M0TA 2R79A 4RE5A 4O4JA 3K71B 1NAIA 5IAOA 4I2VA 2RAVA 3HXTA 4JL5A 4JH0A 2ECKA 2QIOA 2IYLD 5J2TA 3EVBA 1XVVA 1A71A 3DOIA 5CLQA 4JUBA 4TXMA 4M1TA 4R1TA 1G1MA 4A8PA 2D5BA 4RNCA 1HL7A 1ATZA 1UZAA 1VDMA 2UZIR 3G79A 4KRGA 4PYKA 3UYLA 4BVHA 1FTNA 5JAUA 1N9KA 4BFUA 1N77A 5JRJA 2HIAA 1JZSA 1Z2CA 2NV0A 4M1OA 2JFUA 4KE9A 3EGXB 2ZSAA 4LKOA 3NO4A 4HS4A 4QJBA 4HFJA 5EIFA 2B98A 2GFQA 1IOWA 3Q7IA 4HR7A 2O0MA 3GEEA 3HJRA 4TKVB 1ACLA 1ESMA 3SICE 4CR8A 4HMOA 4WFIA 1GGJA 2QMUA 3LC1O 1FEZA 4GMHA 4HTFB 5F1KA 1PZEA 2Z2ZA 2OK8A 1MHTA 4QDTA 3NETA 3AJ8A 2VR1A 5CW2A 1B7GO 4QELA 4N49A 5ER9A 4HX5A 1LTQA 4F9GA 1H1LB 1Z37A 4NZMA 2OAP1 1CJCA 2YICA 3SBXA 2XH8A 3SZUA 1YJAA 4R7ZA 4PLWA 3SS8A 2QTHA 3BEOA 2IP1A 3MJRA 4C0QC 4G1UC 4BQOA 5BQFA 1M7HA 2WHYA 3A14A 3L01A 2L2QA 1HK7A 2IZ7A 4QUAA 5DNVA 3RSSA 3RBZA 1ICEA 1Y1PA 4D9IA 3E9QA 1P2FA 1DEKA 3F5SA 2WSSD 1JHYA 3K8YA 3E7FA 3F6SA 1E5LA 2NV6A 3P4UA 3ECSA 4NF2A 4MVJI 1LQUA 1MEEA 1AKRA 3ANMA 3CVXA 2D3TA 4BO7A 3AF2A 3BXPA 4CU2A 5AJVB 2AZ4A 4L3OA 4NU6A 3KR2A 4WXMA 2JATA 2WR8A 2Y1DA 3T9DA 3DHWC 1GITA 1CS0B 1YHYA 3PWTA 3VFDA 5EUQB 3QUSA 4URUR 1YGYA 4F8YA 3L06A 1JECA 4HWSA 4A2PA 3IT0A 4JX8A 3L7YA 2R6R1 5AQEA 3F96A 3DMDA 3E48A 1BE0A 2WHXA 3F7MA 4HQ0A 2W2KA 1QUFA 2BT4A 2FPUA 4M7PA 2XX3A 4RGVA 3OEYA 1UOQA 2QTMA 3KB1A 5CA0A 1RADA 2A3RA 4JZYA 1KH3A 2QMQA 2QD2A 4Q7KA 3V6LA 4AZ0B 1I3KA 4BS9A 2I2DA 4IRUB 1UKVY 2WAYA 2H16A 2JHPA 3OZIA 3OPVA 2YVLA 4QPPA 3WIOA 3V8BA 2J6IA 2Q1WA 4TPKA 4U7TB 3LSYA 3OLQA 1OGJA 3BBPA 5PNTA 2OLJA 3KKPA 4HNGA 3U4MA 3U44B 3SXUA 1MAHA 2FSVA 3FMPB 4PSCA 3HVKA 3WIVA 1AKMA 1RU3A 3O38A 1FRFS 1FXUA 1VG0B 3CXRA 3V4FA 4BO0A 4CM9A 1QX4A 4UHBA 3U3MA 3W78A 2BM1A 1Z34A 3I37X 5KAMA 4HQKA 3FBGA 1HYGA 2A78A 2WZCA 4GP9A 4OIMA 2GPYA 2A1UA 3VR5H 5HKKA 2BRUA 3GZNA 4NQZA 1RWKA 2RJOA 1OJ7A 1RYZA 1DARA 2B2XA 3ABOB 4H27A 4S1NA 1BMFA 5NLLA 3LP8A 5AVZA 2F43A 5K0TA 3EMKA 1PZHA 3K09A 4J7UA 1XZEA 5A9SB 4M1QA 4EQZA 4IGFA 4CW7A 2DRIA 5ALLA 1AZWA 2R1ZA 4TT3A 3D3QA 2IIPA 3RO7A 1WZCA 1I7DA 4XWKA 1E5DA 1DG3A 3ZE2B 1E0KA 2Y1XA 1Z22A 2BJVA 4OBBA 1H2FA 3VR6H 1AJEA 5L6LB 1K2VN 4JY7A 4RV4A 5E9WA 3M4JA 2G67A 4G8BA 4L95C 4INAA 3TECE 4GU5A 2YWXA 1SU6A 3ADBA 1XTTA 1DFGA 3JVEA 4QVGA 4RVNA 2RARA 4Z8XA 2ZTSA 4F7DA 3WNQA 1L1QA 3CKKA 3WL3A 3GJ6A 3W8NA 2X6RA 3L8FA 2AX3A 2YXBA 3M6FA 3R41A 4D44A 1TAGA 2OR3A 4RV5A 3ZCUA 3OQVA 2H6EA 3K1ZA 1C7RA 4IEFB 3X1MA 1J2EA 5C37A 1SXQA 2P2DA 3F49S 3RARA 1Z6YA 1ZNXA 1MAUA 2FQQA 3NKFA 4MV8A 3L8MA 4I1PA 2XGJA 3CNHA 3KWFA 3L07A 4HMPA 5CB8A 3MQ4A 5F5NA 3PHHA 5FXMA 3B6MA 4MVJF 4C3VA 5BVGA 1JFRA 2X1VA 4PAOA 5KMGB 3W9BA 2E3JA 1PZMA 2I2AA 3PC3A 3TTTA 3R0XA 3SY8A 1E89A 4KMMA 5SZHB 1UBJS 3FTNA 4S12A 1KI6A 1SD1A 4V1CA 1RAIA 2V7UA 3QU2A 2POCA 4Q12A 2BDTA 4QDZA 1GTJ1 4RA9B 3V7FA 4FMDF 5C3MA 5DM2A 2ZPUA 1SKMA 1ZH4A 2RCNA 3HKEB 4X45A 1UMKA 1L5FA 2Q27A 3CIOA 4DSTA 3QE9Y 1U4OA 5MN5A 3WOHA 4LJRA 2B8EA 3TBKA 3BWXA 3QE3A 1H69A 1TK2A 3R7WA 4EA9A 2G0AA 1P81A 2VF7A 2XHZA 4TWJA 3LRPA 1XDBA 1UOOA 2F8MA 2OVFA 3Q5DA 3HCEA 1NN5A 3T4XA 2CMFA 1CUGA 3H5WA 1UXKA 3CO5A 2LBPA 1E62A 3OE5A 1FZQA 3CUVA 4JLKA 4BO5A 5JC8A 2HF9A 1WOYA 5F7OA 1ENYA 4KFRA 2PV7A 2C29D 2SECE 3WE7A 3ZHYA 2V98A 3TRHA 1IN4A 1OQAA 1C50A 3NXKA 3P9YA 2MSEB 4KQFA 1DQNA 1PFYA 3KZMA 5DM1A 1G7CA 2P91A 3I1IA 1XXLA 3CF2A 1W1IA 4S2UA 5A62A 1L5WA 1CNFA 3FHOA 1TZBA 1EUDB 1JQLB 1P0CA 2JD0A 1IHPA 2RG7A 2WG2A 1B76A 2NLOA 3B89A 4LECA 4YLYA 2AZMA 3PP8A 1JH9A 4FNAA 5AOVA 4GWLA 1QM5A 4L51A 1A3CA 3E3OA 3H13A 4G1BA 3WRWA 2H59A 3B7PA 1ZMBA 1ONOA 4Y2HA 2X0NA 4OMDA 2OXTA 2F3QA 1L6RA 1K8ZB 2YZ7A 2CVOA 3P45A 3PNKA 4IWNA 1ZSVA 4L4SA 8LDHA 3PPYA 4KQMA 4Y98A 4PBTA 5E3HA 1IDOA 1FMFA 3GFPA 1DHRA 4COKA 5CFPA 5EJ6A 5DHTA 3FA2A 4C78A 4JJKA 3AVYA 3N2NA 1YR8A 2WJVA 5ALXA 1M2GA 1UJCA 1D03A 4MKZA 5JS6A 5FYDA 3I1FA 5I01A 1E1CA 1Z36A 2J67A 4DIUA 2GAAA 4DQUA 3FDJA 2ZSBA 1JR6A 3VKGA 2RGGA 3GWGA 3IMEA 2DJIA 4GM1A 5IDVA 4YRNA 1LDEA 1ZD1A 3D7KA 2M1ZA 2R66A 1F3LA 1WLYA 4IG9A 2B83A 4UBKA 4FU0A 3FGZA 2VJYA 3A6KA 1QAMA 4F56A 1JR3E 1DJPA 3JYNA 5DLDA 3KQMA 3QMWA 4M98A 1C81A 1Y48E 2B94A 3D8SA 3MB5A 4N65A 3OFJA 4OYLA 5TB5A 4F1JA 3BCHA 2UVPA 5KWJA 3J81k 1X92A 1ZXXA 3GT3A 5CIQA 4E22A 3QPWA 5KX5F 2QVCA 1VB3A 4YYZA 2EAUA 4Q1FA 3SZRA 4DQXA 5JFTA 2TRSB 5CD9A 2BM9A 5JNLA 1KJ9A 5CYOA 3VV3A 2O1SA 1Y7LA 3EQ9A 4CV1A 2XZOA 5AKXA 3RYIA 2XDWA 2YRXA 2FSIA 3HMKA 4JX9A 1F38A 2DKOA 4GX0A 4ZOEA 1GNTA 4FBMA 4C01A 5KNBH 3GRPA 2J5RA 2HJHA 1UBOS 4YC7A 2AE2A 2Y0DA 3B51X 3LQ4A 2O7QA 2C1EA 2CVHA 5ESWA 1E79D 2YHSA 2J4FA 4A6EA 1E9SA 2YASA 4LSGA 5ITVA 1ORVA 4G4SP 1I13A 2B20A 3TM5A 4ALJA 3ICWA 3IIEA 3IURA 4FDUA 1T8PA 2GBLC 2X2OA 1E79A 4XEUA 4OGWA 4OO3A 1ZIPA 3K96A 2VK4A 5AKHA 3ZY5A 4A8JB 2XRYA 3HM2A 1ZVJA 4OXKA 4IV5A 4AZ3B 1JKXA 4MRRA 3RCBA 1D5WA 2WAOA 4RJKA 3U7RA 4MEBA 3UVEA 1VMDA 2YINC 2BOVA 4JUCA 4JU9A 4Y2PA 3RKRA 3IUMA 5B6PA 5CEFA 2EKBA 3IUJA 3MMNA 1T6ZA 3PT9A 1UP6A 3R3JA 4TTSA 5SICE 2WP0A 1P6QA 1JLHA 1G42A 3TRKA 3F6BX 3S2ZA 4U2EA 2YV5A 3EH2A 3TLAA 2PU5A 4D4GA 4UM8B 4C29A 2HJGA 4IVRA 1BH2A 5F5LA 4CL0A 3LX4A 2LKCA 3AF4A 7AT1A 3GFOA 2CHGA 2Q9CA 1JU3A 1G98A 1QQTA 1M6EX 1UEXC 2NGRA 3KSDO 3AIKA 4K1XA 1TUBA 3F9CA 2H9IA 3A05A 4V0QA 4KR9A 3HBFA 4JEIA 1GCOA 2G1PA 1FC0A 2IYYA 3V3TA 1KI9A 4FC7A 1XEXB 4JITA 4UQOA 2QJRA 4MB6A 1P72A 3T95A 3EFOB 2UXBB 4MV5A 3IIIA 1I3CA 1KZHA 3Q8XB 3O31A 4MQUA 2X5OA 5GADl 4CQMD 3OIDA 1TZKA 3O73A 4IUCS 3V4LA 2O0LA 4CTOA 3KQYA 3WY9A 4MDHA 4RY9A 5BORA 3NBMA 5F3DA 5BSWA 3HVRA 2GS9A