9CA2A

Engineering the hydrophobic pocket of carbonic anhydrase ii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
255
structure length
255
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAYLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering the hydrophobic pocket of carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
total genus 76
structure length 255
sequence length 255
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1991-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 9ca2A00
5G03A 4R5BA 2WEGA 4CNXA 1CAKA 3K2FA 1CVCA 1TE3X 4Q9YA 2CBAA 1OKLA 4QK1A 8CA2A 4BCWA 2ILIA 1G6VA 3CYUA 4ITOA 4CACA 1XEVA 5A6HA 3DAZA 3M1JA 4CNVA 2QO8A 3P4VA 2NNVA 2VVAX 3W6HA 3L14A 5DOGA 4JSSA 4QK2A 5JESB 3M67A 3PO6A 1A42A 1I90A 4K0TA 1CIMA 2F14A 3F7BA 1CALA 5FNMA 1YO2A 3HS4A 4KNNA 1IF6A 2HNCA 1CA2A 3DCSA 4GL1X 1LZVA 4E5QA 1HEDA 1F2WA 4YYTA 1CNXA 1LUGA 1BNQA 5FLTA 4RUZA 3SBIA 3GZ0A 1CAHA 1CA3A 3S97A 2CBCA 3S77B 3SAXA 5DSQA 5SZ2A 2NMXA 3RLDA 2NNGA 1RJ6A 4HT2A 1BV3A 2NN7A 4Q90A 3KNEA 4WW8A 4M2VA 5SZ1A 2FOYA 3RYXB 4MO8A 3DCWA 2HFWA 2WEOA 5FNLA 4QIYA 3HLJA 2Q38A 4XFWA 5DSRA 4C3TA 5BRUA 4TWLA 5CACA 3P44A 3OYQA 5E2MA 1FR4A 1IF5A 1ZFKA 1DCBA 3MHIA 4QSAA 1CILA 4L5VA 4PZHA 5SZ4A 3RG3A 4ZWIA 4E9OX 4HT0A 1CVDA 5EKMA 2NWOA 3RZ5A 1G0FA 5EZTX 3M2YA 1TB0X 4E3DA 1RAZA 1G1DA 5EH8A 5FL5A 3P58A 3S9TA 1YDBA 5FNGA 2ABEA 4ILXA 2FOVA 1CVHA 4CNWA 4Q7VA 3JXGA 3T5UA 2NXRA 3S75B 3M5SA 3M40A 1G48A 4PQ7A 2HL4A 1MUAA 1ZSCA 1CNWA 1IF9A 5JGTB 2HOCA 3MWOA 3NJ9A 3V2JA 2NXSA 1OKNA 1KWQA 4LP6A 1FQLA 1ZFQA 4KP8A 5DVXA 4Q99A 5FL6A 4QJXA 4IWZA 3MHMA 3M2NA 4CNRA 1IF8A 3DV7A 5JEPB 2CBDA 3CZVA 3DBUA 3HKNA 3M5TA 4QK3A 2FNMA 2FOSA 1AVNA 3KONA 2CBEA 4Q8ZA 1FQRA 4QSJA 1G4OA 4KAPA 5FNKA 1H9QA 2ZNCA 1FQNA 4M2WA 1IF7A 1ZNCA 3M04A 3N3JA 1G52A 1TEQX 5FLPA 4RFDA 4K13A 5SZ0A 4QIZA 3D8WA 4ETQC 2X7SA 4Q06A 2WD2A 1ZGFA 4JSAA 3ML5A 4KV0A 4E3GA 1UGCA 5FNJA 1BZMA 1CRMA 5E2NA 1G4JA 4FRCA 1J9WA 3F8EA 3M3XA 3RZ0B 4DZ9A 4RUYA 5EH5A 1I8ZA 4QEFA 3OIKA 4ZWYA 3S74B 3S72B 4K1QA 1XPZA 3T85A 4Q7PA 3T84A 3N0NA 1BNVA 4Q49A 1RJ5A 5EKHA 3V2MA 4E3FA 3ZNCA 5FL4A 1CVBA 1IF4A 1AM6A 1CANA 2CABA 3CA2A 4Q7SA 3ZP9A 2FMZA 4TWMA 3P55A 3T82A 3M2XA 2NWPA 4BF6A 5E2SA 5FLOA 5BNLA 1I9OA 4MTYA 3HKQA 1CAZA 1UGAA 2WEHA 1UGDA 3NI5A 1UGEA 1DMYA 3CAJA 4XIXA 5JEGB 3K7KA 1CNKA 1G54A 5A25A 3M5EA 5EH7A 3V3JA 5FDCA 4JS6A 3RG4A 5IPZA 3FE4A 5AMGA 4ZX1A 2GD8A 1TEUX 4Y0JA 1FQMA 5E2KA 4E3HA 3EFIA 1AZMA 2WD3A 4XE1A 1CNIA 4DZ7A 1DMXA 1ZE8A 1KEQA 3MYQA 2HKKA 1H9NA 3OKUA 3UYQA 4WUQA 1CNGA 4R5AA 1OQ5A 1OKMA 5SZ6A 3MNUA 1V9IC 1BN3A 1G0EA 2FOQA 3MNKA 3N2PA 1LG5A 4G7AA 4Q78A 4WW6A 3D9ZA 1HCAA 5BRVA 3S8XA 3SBHA 3OILA 1CVAA 3BL0A 1I9MA 3R17B 4HF3A 5E5UA 3DVBA 1V9EA 3KOKA 1EOUA 3NB5A 4RIVA 4ZAOA 3RYZA 1JD0A 3T5ZA 3IGPA 5JG3B 4UOVA 5EKJA 4K0SA 2WEJA 1I9NA 2IT4A 4L5UA 4IDRX 4E49A 3TVNX 3RZ8A 1I9PA 5DSKA 4Q83A 4Q8YA 2VVBX 5E28A 4QY3A 4BF1A 3N4BA 4COQA 2Q1BA 4Q7WA 4Z1JA 3PYKA 5BYIA 3D93A 4ITPA 5CJFA 3HFPA 2FOUA 3IAIA 4Q09A 1FSQA 1CINA 5FDIA 5JQTA 3S73B 3OYSA 4K0ZA 1G53A 1HEBA 3V3HB 3DVDA 3MMFA 3U7CA 5AMLA 4PYXA 2OSMA 3KIGA 1BCDA 3TMJA 3BETA 4Q07A 3M14A 4QJWA 4L5WA 3RGEA 3M2ZA 1BN1A 2EZ7A 5JGSB 1JCZA 4Q0LA 3RYYA 1FSRA 3DC9A 4WR7A 3ML2A 5FLQA 4YGLA 3MDZA 5AMDA 2X7UA 4QJOA 1YDCA 3P3HA 1UGFA 1LG6A 1I9LA 4MDGA 1BNWA 5G01A 1FR7A 4RFCA 3MZCA 1HEAA 4FIKA 3RZ1B 4FPTA 2EU2A 3R16A 1Z93A 3DVCA 4YXOA 1CCSA 4RIUA 2GEHA 4ZWZA 3IBLA 2O4ZA 3OKVA 3RYVB 5G0CA 3S78B 5JEHB 2NXTA 3B4FA 3MNHA 3FFPX 3V3FA 4KP5A 3KWAA 3UYNA 3MHCA 3OY0A 2NN1A 3MHOA 2Q1QA 1CVEA 4WL4A 4Q6EA 3D92A 5SZ5A 4N16A 2HD6A 5DSPA 3W6IA 4KNMA 1RZAA 2X7TA 4X5SA 3F7UA 4Q87A 1FSNA 2W2JA 4MDLA 4YGFA 5EHWA 9CA2A 2CBBA 1CAMA 4M2RA 4KUVA 4HEZA 1BNMA 5DSNA 3HKTA 3V7XA 4HU1A 2AX2A 4YGNA 2NNSA 3DCCA 3JXHC 1I91A 4JSZA 3PJJA 4Z1NA 3M98A 4QJ0A 4WUPA 5HPJA 1TTMA 5E2RA 5DSJA 3F4XA 3QYKA 4FL7A 3V3GB 3B1BA 4G0CA 5DSOA 3RZ7A 1LGDA 3JXFA 5G0BA 1TG9A 1HCBA 4RN4A 1CRAA 5SZ7A 1CCTA 5C8IA 5FNIA 4HEWA 5DRSA 1CNBA 2CA2A 5E5RA 5DSIA 3S76A 4Q08A 4MDMA 2QP6A 3IEOA 3SAPA 4E4AA 1BNNA 3MNAA 1YDDA 2NWZA 1RZCA 5JG5B 3M1KA 1G46A 4MLTA 4QJPA 4XZ5A 1JV0A 4RUXA 3MNJA 2POWA 5J8ZA 1KOPA 3VBDA 3M96A 2POVA 1XEGA 1URTA 1HUHA 1CNYA 4QJMA 4MLXA 4QSBA 2EU3A 3BL1A 3OIMA 4Z0QA 4QSIA 1FLJA 1ZSAA 5JDVB 3T83A 3DD8A 1CAYA 4ZX0A 1HVAA 3MHLA 5EHEA 3KS3A 4FU5A 1CAIA 1G3ZA 4YGJA 3U47A 3KKXA 1T9NA 3DC3A 3K34A 1TBTX 1ZH9A 5L6KA 4QTLA 5JQ0A 1CAOA 1RAYA 2QOAA 4LHIA 3RJ7A 3EFTA 1RZBA 1Z97A 5LMDA 4FVNA 1CVFA 1XQ0A 1UGBA 3P3JA 3P5AA 1YDAA 4YX4A 5DSMA 5FNHA 5SZ3A 1BICA 3M1QA 3FW3A 3M1WA 1CZMA 4Z1EA 1Z9YA 3KOIA 2NNOA 4ZWXA 1TG3A 5EIJA 2OSFA 3MNIA 1CCUA 4YXIA 4YHAA 4XIWA 3HKUA 4Q81A 1RZDA 3IBNA 4KNJA 1Y7WA 5FLSA 1H4NA 2AW1A 4Q8XA 1ZSBA 4FVOA 1TH9A 3P5LA 4LU3A 3TVOX 1YO1A 2FNKA 1THKA 4M2UA 1YO0A 5BRWA 2NWYA 3U3AX 4YXUA 3V5GA 5EHVA 12CAA 3DD0A 4PXXA 1CNCA 4JSWA 3DA2A 4KUYA 3D0NA 2H4NA 3KLDB 2FNNA 2FW4A 1KWRA 5DSLA 1MOOA 4CQ0A 1I9QA 1BN4A 1HUGA 2H15A 1ZGEA 4Z1KA 4KUWA 7CA2A 5L3OA 4YWPA 4R59A 4Q6DA 3U45X 5EOIA 3C7PA 1BNUA 1UGGA 6CA2A 4N0XB 1HECA 3RYJB 4YGKA 3IBIA 5DOHA 4YVYA 3S71B 4HEYA 5CA2A 4HBAA 2POUA 3Q31A 5CLUA 1DCAA 1KOQA 3LXEA 4CA2A 3V3IB 2FMGA 4RH2A 4PYYA 1BNTA 1CNHA 4KNIA 1CNJA 1G45A 1RZEA 5FLRA 3IBUA 1CAJA
chains in the Genus database with same CATH superfamily
5G03A 4R5BA 2WEGA 4CNXA 1CAKA 3K2FA 1CVCA 1TE3X 4Q9YA 2CBAA 1OKLA 4QK1A 8CA2A 4BCWA 2ILIA 1G6VA 3CYUA 4ITOA 4CACA 1XEVA 5A6HA 3DAZA 3M1JA 4CNVA 2QO8A 3P4VA 2NNVA 2VVAX 3W6HA 3L14A 5DOGA 4JSSA 4QK2A 5JESB 3M67A 3PO6A 1A42A 1I90A 4K0TA 1CIMA 2F14A 3F7BA 1CALA 5FNMA 1YO2A 3HS4A 4KNNA 1IF6A 2HNCA 1CA2A 3DCSA 4GL1X 1LZVA 4E5QA 1HEDA 1F2WA 4YYTA 1CNXA 1LUGA 1BNQA 5FLTA 4RUZA 3SBIA 3GZ0A 1CAHA 1CA3A 3S97A 2CBCA 3S77B 3SAXA 5DSQA 5SZ2A 2NMXA 3RLDA 2NNGA 1RJ6A 4HT2A 1BV3A 2NN7A 4Q90A 3KNEA 4WW8A 4M2VA 5SZ1A 2FOYA 3RYXB 4MO8A 3DCWA 2HFWA 2WEOA 5FNLA 4QIYA 3HLJA 2Q38A 4XFWA 5DSRA 4C3TA 5BRUA 4TWLA 5CACA 3P44A 3OYQA 5E2MA 1FR4A 1IF5A 1ZFKA 1DCBA 3MHIA 4QSAA 1CILA 4L5VA 4PZHA 5SZ4A 3RG3A 4ZWIA 4E9OX 4HT0A 1CVDA 5EKMA 2NWOA 3RZ5A 1G0FA 5EZTX 3M2YA 1TB0X 4E3DA 1RAZA 1G1DA 5EH8A 5FL5A 3P58A 3S9TA 1YDBA 5FNGA 2ABEA 4ILXA 2FOVA 1CVHA 4CNWA 4Q7VA 3JXGA 3T5UA 2NXRA 3S75B 3M5SA 3M40A 1G48A 4PQ7A 2HL4A 1MUAA 1ZSCA 1CNWA 1IF9A 5JGTB 2HOCA 3MWOA 3NJ9A 3V2JA 2NXSA 1OKNA 1KWQA 4LP6A 1FQLA 1ZFQA 4KP8A 5DVXA 4Q99A 5FL6A 4QJXA 4IWZA 3MHMA 3M2NA 4CNRA 1IF8A 3DV7A 5JEPB 2CBDA 3CZVA 3DBUA 3HKNA 3M5TA 4QK3A 2FNMA 2FOSA 1AVNA 3KONA 2CBEA 4Q8ZA 1FQRA 4QSJA 1G4OA 4KAPA 5FNKA 1H9QA 2ZNCA 1FQNA 4M2WA 1IF7A 1ZNCA 3M04A 3N3JA 1G52A 1TEQX 5FLPA 4RFDA 4K13A 5SZ0A 4QIZA 3D8WA 4ETQC 2X7SA 4Q06A 2WD2A 1ZGFA 4JSAA 3ML5A 4KV0A 4E3GA 1UGCA 5FNJA 1BZMA 1CRMA 5E2NA 1G4JA 4FRCA 1J9WA 3F8EA 3M3XA 3RZ0B 4DZ9A 4RUYA 5EH5A 1I8ZA 4QEFA 3OIKA 4ZWYA 3S74B 3S72B 4K1QA 1XPZA 3T85A 4Q7PA 3T84A 3N0NA 1BNVA 4Q49A 1RJ5A 5EKHA 3V2MA 4E3FA 3ZNCA 5FL4A 1CVBA 1IF4A 1AM6A 1CANA 2CABA 3CA2A 4Q7SA 3ZP9A 2FMZA 4TWMA 3P55A 3T82A 3M2XA 2NWPA 4BF6A 5E2SA 5FLOA 5BNLA 1I9OA 4MTYA 3HKQA 1CAZA 1UGAA 2WEHA 1UGDA 3NI5A 1UGEA 1DMYA 3CAJA 4XIXA 5JEGB 3K7KA 1CNKA 1G54A 5A25A 3M5EA 5EH7A 3V3JA 5FDCA 4JS6A 3RG4A 5IPZA 3FE4A 5AMGA 4ZX1A 2GD8A 1TEUX 4Y0JA 1FQMA 5E2KA 4E3HA 3EFIA 1AZMA 2WD3A 4XE1A 1CNIA 4DZ7A 1DMXA 1ZE8A 1KEQA 3MYQA 2HKKA 1H9NA 3OKUA 3UYQA 4WUQA 1CNGA 4R5AA 1OQ5A 1OKMA 5SZ6A 3MNUA 1V9IC 1BN3A 1G0EA 2FOQA 3MNKA 3N2PA 1LG5A 4G7AA 4Q78A 4WW6A 3D9ZA 1HCAA 5BRVA 3S8XA 3SBHA 3OILA 1CVAA 3BL0A 1I9MA 3R17B 4HF3A 5E5UA 3DVBA 1V9EA 3KOKA 1EOUA 3NB5A 4RIVA 4ZAOA 3RYZA 1JD0A 3T5ZA 3IGPA 5JG3B 4UOVA 5EKJA 4K0SA 2WEJA 1I9NA 2IT4A 4L5UA 4IDRX 4E49A 3TVNX 3RZ8A 1I9PA 5DSKA 4Q83A 4Q8YA 2VVBX 5E28A 4QY3A 4BF1A 3N4BA 4COQA 2Q1BA 4Q7WA 4Z1JA 3PYKA 5BYIA 3D93A 4ITPA 5CJFA 3HFPA 2FOUA 3IAIA 4Q09A 1FSQA 1CINA 5FDIA 5JQTA 3S73B 3OYSA 4K0ZA 1G53A 1HEBA 3V3HB 3DVDA 3MMFA 3U7CA 5AMLA 4PYXA 2OSMA 3KIGA 1BCDA 3TMJA 3BETA 4Q07A 3M14A 4QJWA 4L5WA 3RGEA 3M2ZA 1BN1A 2EZ7A 5JGSB 1JCZA 4Q0LA 3RYYA 1FSRA 3DC9A 4WR7A 3ML2A 5FLQA 4YGLA 3MDZA 5AMDA 2X7UA 4QJOA 1YDCA 3P3HA 1UGFA 1LG6A 1I9LA 4MDGA 1BNWA 5G01A 1FR7A 4RFCA 3MZCA 1HEAA 4FIKA 3RZ1B 4FPTA 2EU2A 3R16A 1Z93A 3DVCA 4YXOA 1CCSA 4RIUA 2GEHA 4ZWZA 3IBLA 2O4ZA 3OKVA 3RYVB 5G0CA 3S78B 5JEHB 2NXTA 3B4FA 3MNHA 3FFPX 3V3FA 4KP5A 3KWAA 3UYNA 3MHCA 3OY0A 2NN1A 3MHOA 2Q1QA 1CVEA 4WL4A 4Q6EA 3D92A 5SZ5A 4N16A 2HD6A 5DSPA 3W6IA 4KNMA 1RZAA 2X7TA 4X5SA 3F7UA 4Q87A 1FSNA 2W2JA 4MDLA 4YGFA 5EHWA 9CA2A 2CBBA 1CAMA 4M2RA 4KUVA 4HEZA 1BNMA 5DSNA 3HKTA 3V7XA 4HU1A 2AX2A 4YGNA 2NNSA 3DCCA 3JXHC 1I91A 4JSZA 3PJJA 4Z1NA 3M98A 4QJ0A 4WUPA 5HPJA 1TTMA 5E2RA 5DSJA 3F4XA 3QYKA 4FL7A 3V3GB 3B1BA 4G0CA 5DSOA 3RZ7A 1LGDA 3JXFA 5G0BA 1TG9A 1HCBA 4RN4A 1CRAA 5SZ7A 1CCTA 5C8IA 5FNIA 4HEWA 5DRSA 1CNBA 2CA2A 5E5RA 5DSIA 3S76A 4Q08A 4MDMA 2QP6A 3IEOA 3SAPA 4E4AA 1BNNA 3MNAA 1YDDA 2NWZA 1RZCA 5JG5B 3M1KA 1G46A 4MLTA 4QJPA 4XZ5A 1JV0A 4RUXA 3MNJA 2POWA 5J8ZA 1KOPA 3VBDA 3M96A 2POVA 1XEGA 1URTA 1HUHA 1CNYA 4QJMA 4MLXA 4QSBA 2EU3A 3BL1A 3OIMA 4Z0QA 4QSIA 1FLJA 1ZSAA 5JDVB 3T83A 3DD8A 1CAYA 4ZX0A 1HVAA 3MHLA 5EHEA 3KS3A 4FU5A 1CAIA 1G3ZA 4YGJA 3U47A 3KKXA 1T9NA 3DC3A 3K34A 1TBTX 1ZH9A 5L6KA 4QTLA 5JQ0A 1CAOA 1RAYA 2QOAA 4LHIA 3RJ7A 3EFTA 1RZBA 1Z97A 5LMDA 4FVNA 1CVFA 1XQ0A 1UGBA 3P3JA 3P5AA 1YDAA 4YX4A 5DSMA 5FNHA 5SZ3A 1BICA 3M1QA 3FW3A 3M1WA 1CZMA 4Z1EA 1Z9YA 3KOIA 2NNOA 4ZWXA 1TG3A 5EIJA 2OSFA 3MNIA 1CCUA 4YXIA 4YHAA 4XIWA 3HKUA 4Q81A 1RZDA 3IBNA 4KNJA 1Y7WA 5FLSA 1H4NA 2AW1A 4Q8XA 1ZSBA 4FVOA 1TH9A 3P5LA 4LU3A 3TVOX 1YO1A 2FNKA 1THKA 4M2UA 1YO0A 5BRWA 2NWYA 3U3AX 4YXUA 3V5GA 5EHVA 12CAA 3DD0A 4PXXA 1CNCA 4JSWA 3DA2A 4KUYA 3D0NA 2H4NA 3KLDB 2FNNA 2FW4A 1KWRA 5DSLA 1MOOA 4CQ0A 1I9QA 1BN4A 1HUGA 2H15A 1ZGEA 4Z1KA 4KUWA 7CA2A 5L3OA 4YWPA 4R59A 4Q6DA 3U45X 5EOIA 3C7PA 1BNUA 1UGGA 6CA2A 4N0XB 1HECA 3RYJB 4YGKA 3IBIA 5DOHA 4YVYA 3S71B 4HEYA 5CA2A 4HBAA 2POUA 3Q31A 5CLUA 1DCAA 1KOQA 3LXEA 4CA2A 3V3IB 2FMGA 4RH2A 4PYYA 1BNTA 1CNHA 4KNIA 1CNJA 1G45A 1RZEA 5FLRA 3IBUA 1CAJA
chains in the Genus database with same CATH topology
5G03A 4R5BA 2WEGA 4CNXA 1CAKA 3K2FA 1CVCA 1TE3X 4Q9YA 2CBAA 1OKLA 4QK1A 8CA2A 4BCWA 2ILIA 1G6VA 3CYUA 4ITOA 4CACA 1XEVA 5A6HA 3DAZA 3M1JA 4CNVA 2QO8A 3P4VA 2NNVA 2VVAX 3W6HA 3L14A 5DOGA 4JSSA 4QK2A 5JESB 3M67A 3PO6A 1A42A 1I90A 4K0TA 1CIMA 2F14A 3F7BA 1CALA 5FNMA 1YO2A 3HS4A 4KNNA 1IF6A 2HNCA 1CA2A 3DCSA 4GL1X 1LZVA 4E5QA 1HEDA 1F2WA 4YYTA 1CNXA 1LUGA 1BNQA 5FLTA 4RUZA 3SBIA 3GZ0A 1CAHA 1CA3A 3S97A 2CBCA 3S77B 3SAXA 5DSQA 5SZ2A 2NMXA 3RLDA 2NNGA 1RJ6A 4HT2A 1BV3A 2NN7A 4Q90A 3KNEA 4WW8A 4M2VA 5SZ1A 2FOYA 3RYXB 4MO8A 3DCWA 2HFWA 2WEOA 5FNLA 4QIYA 3HLJA 2Q38A 4XFWA 5DSRA 4C3TA 5BRUA 4TWLA 5CACA 3P44A 3OYQA 5E2MA 1FR4A 1IF5A 1ZFKA 1DCBA 3MHIA 4QSAA 1CILA 4L5VA 4PZHA 5SZ4A 3RG3A 4ZWIA 4E9OX 4HT0A 1CVDA 5EKMA 2NWOA 3RZ5A 1G0FA 5EZTX 3M2YA 1TB0X 4E3DA 1RAZA 1G1DA 5EH8A 5FL5A 3P58A 3S9TA 1YDBA 5FNGA 2ABEA 4ILXA 2FOVA 1CVHA 4CNWA 4Q7VA 3JXGA 3T5UA 2NXRA 3S75B 3M5SA 3M40A 1G48A 4PQ7A 2HL4A 1MUAA 1ZSCA 1CNWA 1IF9A 5JGTB 2HOCA 3MWOA 3NJ9A 3V2JA 2NXSA 1OKNA 1KWQA 4LP6A 1FQLA 1ZFQA 4KP8A 5DVXA 4Q99A 5FL6A 4QJXA 4IWZA 3MHMA 3M2NA 4CNRA 1IF8A 3DV7A 5JEPB 2CBDA 3CZVA 3DBUA 3HKNA 3M5TA 4QK3A 2FNMA 2FOSA 1AVNA 3KONA 2CBEA 4Q8ZA 1FQRA 4QSJA 1G4OA 4KAPA 5FNKA 1H9QA 2ZNCA 1FQNA 4M2WA 1IF7A 1ZNCA 3M04A 3N3JA 1G52A 1TEQX 5FLPA 4RFDA 4K13A 5SZ0A 4QIZA 3D8WA 4ETQC 2X7SA 4Q06A 2WD2A 1ZGFA 4JSAA 3ML5A 4KV0A 4E3GA 1UGCA 5FNJA 1BZMA 1CRMA 5E2NA 1G4JA 4FRCA 1J9WA 3F8EA 3M3XA 3RZ0B 4DZ9A 4RUYA 5EH5A 1I8ZA 4QEFA 3OIKA 4ZWYA 3S74B 3S72B 4K1QA 1XPZA 3T85A 4Q7PA 3T84A 3N0NA 1BNVA 4Q49A 1RJ5A 5EKHA 3V2MA 4E3FA 3ZNCA 5FL4A 1CVBA 1IF4A 1AM6A 1CANA 2CABA 3CA2A 4Q7SA 3ZP9A 2FMZA 4TWMA 3P55A 3T82A 3M2XA 2NWPA 4BF6A 5E2SA 5FLOA 5BNLA 1I9OA 4MTYA 3HKQA 1CAZA 1UGAA 2WEHA 1UGDA 3NI5A 1UGEA 1DMYA 3CAJA 4XIXA 5JEGB 3K7KA 1CNKA 1G54A 5A25A 3M5EA 5EH7A 3V3JA 5FDCA 4JS6A 3RG4A 5IPZA 3FE4A 5AMGA 4ZX1A 2GD8A 1TEUX 4Y0JA 1FQMA 5E2KA 4E3HA 3EFIA 1AZMA 2WD3A 4XE1A 1CNIA 4DZ7A 1DMXA 1ZE8A 1KEQA 3MYQA 2HKKA 1H9NA 3OKUA 3UYQA 4WUQA 1CNGA 4R5AA 1OQ5A 1OKMA 5SZ6A 3MNUA 1V9IC 1BN3A 1G0EA 2FOQA 3MNKA 3N2PA 1LG5A 4G7AA 4Q78A 4WW6A 3D9ZA 1HCAA 5BRVA 3S8XA 3SBHA 3OILA 1CVAA 3BL0A 1I9MA 3R17B 4HF3A 5E5UA 3DVBA 1V9EA 3KOKA 1EOUA 3NB5A 4RIVA 4ZAOA 3RYZA 1JD0A 3T5ZA 3IGPA 5JG3B 4UOVA 5EKJA 4K0SA 2WEJA 1I9NA 2IT4A 4L5UA 4IDRX 4E49A 3TVNX 3RZ8A 1I9PA 5DSKA 4Q83A 4Q8YA 2VVBX 5E28A 4QY3A 4BF1A 3N4BA 4COQA 2Q1BA 4Q7WA 4Z1JA 3PYKA 5BYIA 3D93A 4ITPA 5CJFA 3HFPA 2FOUA 3IAIA 4Q09A 1FSQA 1CINA 5FDIA 5JQTA 3S73B 3OYSA 4K0ZA 1G53A 1HEBA 3V3HB 3DVDA 3MMFA 3U7CA 5AMLA 4PYXA 2OSMA 3KIGA 1BCDA 3TMJA 3BETA 4Q07A 3M14A 4QJWA 4L5WA 3RGEA 3M2ZA 1BN1A 2EZ7A 5JGSB 1JCZA 4Q0LA 3RYYA 1FSRA 3DC9A 4WR7A 3ML2A 5FLQA 4YGLA 3MDZA 5AMDA 2X7UA 4QJOA 1YDCA 3P3HA 1UGFA 1LG6A 1I9LA 4MDGA 1BNWA 5G01A 1FR7A 4RFCA 3MZCA 1HEAA 4FIKA 3RZ1B 4FPTA 2EU2A 3R16A 1Z93A 3DVCA 4YXOA 1CCSA 4RIUA 2GEHA 4ZWZA 3IBLA 2O4ZA 3OKVA 3RYVB 5G0CA 3S78B 5JEHB 2NXTA 3B4FA 3MNHA 3FFPX 3V3FA 4KP5A 3KWAA 3UYNA 3MHCA 3OY0A 2NN1A 3MHOA 2Q1QA 1CVEA 4WL4A 4Q6EA 3D92A 5SZ5A 4N16A 2HD6A 5DSPA 3W6IA 4KNMA 1RZAA 2X7TA 4X5SA 3F7UA 4Q87A 1FSNA 2W2JA 4MDLA 4YGFA 5EHWA 9CA2A 2CBBA 1CAMA 4M2RA 4KUVA 4HEZA 1BNMA 5DSNA 3HKTA 3V7XA 4HU1A 2AX2A 4YGNA 2NNSA 3DCCA 3JXHC 1I91A 4JSZA 3PJJA 4Z1NA 3M98A 4QJ0A 4WUPA 5HPJA 1TTMA 5E2RA 5DSJA 3F4XA 3QYKA 4FL7A 3V3GB 3B1BA 4G0CA 5DSOA 3RZ7A 1LGDA 3JXFA 5G0BA 1TG9A 1HCBA 4RN4A 1CRAA 5SZ7A 1CCTA 5C8IA 5FNIA 4HEWA 5DRSA 1CNBA 2CA2A 5E5RA 5DSIA 3S76A 4Q08A 4MDMA 2QP6A 3IEOA 3SAPA 4E4AA 1BNNA 3MNAA 1YDDA 2NWZA 1RZCA 5JG5B 3M1KA 1G46A 4MLTA 4QJPA 4XZ5A 1JV0A 4RUXA 3MNJA 2POWA 5J8ZA 1KOPA 3VBDA 3M96A 2POVA 1XEGA 1URTA 1HUHA 1CNYA 4QJMA 4MLXA 4QSBA 2EU3A 3BL1A 3OIMA 4Z0QA 4QSIA 1FLJA 1ZSAA 5JDVB 3T83A 3DD8A 1CAYA 4ZX0A 1HVAA 3MHLA 5EHEA 3KS3A 4FU5A 1CAIA 1G3ZA 4YGJA 3U47A 3KKXA 1T9NA 3DC3A 3K34A 1TBTX 1ZH9A 5L6KA 4QTLA 5JQ0A 1CAOA 1RAYA 2QOAA 4LHIA 3RJ7A 3EFTA 1RZBA 1Z97A 5LMDA 4FVNA 1CVFA 1XQ0A 1UGBA 3P3JA 3P5AA 1YDAA 4YX4A 5DSMA 5FNHA 5SZ3A 1BICA 3M1QA 3FW3A 3M1WA 1CZMA 4Z1EA 1Z9YA 3KOIA 2NNOA 4ZWXA 1TG3A 5EIJA 2OSFA 3MNIA 1CCUA 4YXIA 4YHAA 4XIWA 3HKUA 4Q81A 1RZDA 3IBNA 4KNJA 1Y7WA 5FLSA 1H4NA 2AW1A 4Q8XA 1ZSBA 4FVOA 1TH9A 3P5LA 4LU3A 3TVOX 1YO1A 2FNKA 1THKA 4M2UA 1YO0A 5BRWA 2NWYA 3U3AX 4YXUA 3V5GA 5EHVA 12CAA 3DD0A 4PXXA 1CNCA 4JSWA 3DA2A 4KUYA 3D0NA 2H4NA 3KLDB 2FNNA 2FW4A 1KWRA 5DSLA 1MOOA 4CQ0A 1I9QA 1BN4A 1HUGA 2H15A 1ZGEA 4Z1KA 4KUWA 7CA2A 5L3OA 4YWPA 4R59A 4Q6DA 3U45X 5EOIA 3C7PA 1BNUA 1UGGA 6CA2A 4N0XB 1HECA 3RYJB 4YGKA 3IBIA 5DOHA 4YVYA 3S71B 4HEYA 5CA2A 4HBAA 2POUA 3Q31A 5CLUA 1DCAA 1KOQA 3LXEA 4CA2A 3V3IB 2FMGA 4RH2A 4PYYA 1BNTA 1CNHA 4KNIA 1CNJA 1G45A 1RZEA 5FLRA 3IBUA 1CAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G03 A;  4R5B A;  2WEG A;  4CNX A;  1CAK A;  3K2F A;  1CVC A;  1TE3 X;  4Q9Y A;  2CBA A;  1OKL A;  4QK1 A;  8CA2 A;  4BCW A;  2ILI A;  1G6V A;  3CYU A;  4ITO A;  4CAC A;  1XEV A;  5A6H A;  3DAZ A;  3M1J A;  4CNV A;  2QO8 A;  3P4V A;  2NNV A;  2VVA X;  3W6H A;  3L14 A;  5DOG A;  4JSS A;  4QK2 A;  5JES B;  3M67 A;  3PO6 A;  1A42 A;  1I90 A;  4K0T A;  1CIM A;  2F14 A;  3F7B A;  1CAL A;  5FNM A;  1YO2 A;  3HS4 A;  4KNN A;  1IF6 A;  2HNC A;  1CA2 A;  3DCS A;  4GL1 X;  1LZV A;  4E5Q A;  1HED A;  1F2W A;  4YYT A;  1CNX A;  1LUG A;  1BNQ A;  5FLT A;  4RUZ A;  3SBI A;  3GZ0 A;  1CAH A;  1CA3 A;  3S97 A;  2CBC A;  3S77 B;  3SAX A;  5DSQ A;  5SZ2 A;  2NMX A;  3RLD A;  2NNG A;  1RJ6 A;  4HT2 A;  1BV3 A;  2NN7 A;  4Q90 A;  3KNE A;  4WW8 A;  4M2V A;  5SZ1 A;  2FOY A;  3RYX B;  4MO8 A;  3DCW A;  2HFW A;  2WEO A;  5FNL A;  4QIY A;  3HLJ A;  2Q38 A;  4XFW A;  5DSR A;  4C3T A;  5BRU A;  4TWL A;  5CAC A;  3P44 A;  3OYQ A;  5E2M A;  1FR4 A;  1IF5 A;  1ZFK A;  1DCB A;  3MHI A;  4QSA A;  1CIL A;  4L5V A;  4PZH A;  5SZ4 A;  3RG3 A;  4ZWI A;  4E9O X;  4HT0 A;  1CVD A;  5EKM A;  2NWO A;  3RZ5 A;  1G0F A;  5EZT X;  3M2Y A;  1TB0 X;  4E3D A;  1RAZ A;  1G1D A;  5EH8 A;  5FL5 A;  3P58 A;  3S9T A;  1YDB A;  5FNG A;  2ABE A;  4ILX A;  2FOV A;  1CVH A;  4CNW A;  4Q7V A;  3JXG A;  3T5U A;  2NXR A;  3S75 B;  3M5S A;  3M40 A;  1G48 A;  4PQ7 A;  2HL4 A;  1MUA A;  1ZSC A;  1CNW A;  1IF9 A;  5JGT B;  2HOC A;  3MWO A;  3NJ9 A;  3V2J A;  2NXS A;  1OKN A;  1KWQ A;  4LP6 A;  1FQL A;  1ZFQ A;  4KP8 A;  5DVX A;  4Q99 A;  5FL6 A;  4QJX A;  4IWZ A;  3MHM A;  3M2N A;  4CNR A;  1IF8 A;  3DV7 A;  5JEP B;  2CBD A;  3CZV A;  3DBU A;  3HKN A;  3M5T A;  4QK3 A;  2FNM A;  2FOS A;  1AVN A;  3KON A;  2CBE A;  4Q8Z A;  1FQR A;  4QSJ A;  1G4O A;  4KAP A;  5FNK A;  1H9Q A;  2ZNC A;  1FQN A;  4M2W A;  1IF7 A;  1ZNC A;  3M04 A;  3N3J A;  1G52 A;  1TEQ X;  5FLP A;  4RFD A;  4K13 A;  5SZ0 A;  4QIZ A;  3D8W A;  4ETQ C;  2X7S A;  4Q06 A;  2WD2 A;  1ZGF A;  4JSA A;  3ML5 A;  4KV0 A;  4E3G A;  1UGC A;  5FNJ A;  1BZM A;  1CRM A;  5E2N A;  1G4J A;  4FRC A;  1J9W A;  3F8E A;  3M3X A;  3RZ0 B;  4DZ9 A;  4RUY A;  5EH5 A;  1I8Z A;  4QEF A;  3OIK A;  4ZWY A;  3S74 B;  3S72 B;  4K1Q A;  1XPZ A;  3T85 A;  4Q7P A;  3T84 A;  3N0N A;  1BNV A;  4Q49 A;  1RJ5 A;  5EKH A;  3V2M A;  4E3F A;  3ZNC A;  5FL4 A;  1CVB A;  1IF4 A;  1AM6 A;  1CAN A;  2CAB A;  3CA2 A;  4Q7S A;  3ZP9 A;  2FMZ A;  4TWM A;  3P55 A;  3T82 A;  3M2X A;  2NWP A;  4BF6 A;  5E2S A;  5FLO A;  5BNL A;  1I9O A;  4MTY A;  3HKQ A;  1CAZ A;  1UGA A;  2WEH A;  1UGD A;  3NI5 A;  1UGE A;  1DMY A;  3CAJ A;  4XIX A;  5JEG B;  3K7K A;  1CNK A;  1G54 A;  5A25 A;  3M5E A;  5EH7 A;  3V3J A;  5FDC A;  4JS6 A;  3RG4 A;  5IPZ A;  3FE4 A;  5AMG A;  4ZX1 A;  2GD8 A;  1TEU X;  4Y0J A;  1FQM A;  5E2K A;  4E3H A;  3EFI A;  1AZM A;  2WD3 A;  4XE1 A;  1CNI A;  4DZ7 A;  1DMX A;  1ZE8 A;  1KEQ A;  3MYQ A;  2HKK A;  1H9N A;  3OKU A;  3UYQ A;  4WUQ A;  1CNG A;  4R5A A;  1OQ5 A;  1OKM A;  5SZ6 A;  3MNU A;  1V9I C;  1BN3 A;  1G0E A;  2FOQ A;  3MNK A;  3N2P A;  1LG5 A;  4G7A A;  4Q78 A;  4WW6 A;  3D9Z A;  1HCA A;  5BRV A;  3S8X A;  3SBH A;  3OIL A;  1CVA A;  3BL0 A;  1I9M A;  3R17 B;  4HF3 A;  5E5U A;  3DVB A;  1V9E A;  3KOK A;  1EOU A;  3NB5 A;  4RIV A;  4ZAO A;  3RYZ A;  1JD0 A;  3T5Z A;  3IGP A;  5JG3 B;  4UOV A;  5EKJ A;  4K0S A;  2WEJ A;  1I9N A;  2IT4 A;  4L5U A;  4IDR X;  4E49 A;  3TVN X;  3RZ8 A;  1I9P A;  5DSK A;  4Q83 A;  4Q8Y A;  2VVB X;  5E28 A;  4QY3 A;  4BF1 A;  3N4B A;  4COQ A;  2Q1B A;  4Q7W A;  4Z1J A;  3PYK A;  5BYI A;  3D93 A;  4ITP A;  5CJF A;  3HFP A;  2FOU A;  3IAI A;  4Q09 A;  1FSQ A;  1CIN A;  5FDI A;  5JQT A;  3S73 B;  3OYS A;  4K0Z A;  1G53 A;  1HEB A;  3V3H B;  3DVD A;  3MMF A;  3U7C A;  5AML A;  4PYX A;  2OSM A;  3KIG A;  1BCD A;  3TMJ A;  3BET A;  4Q07 A;  3M14 A;  4QJW A;  4L5W A;  3RGE A;  3M2Z A;  1BN1 A;  2EZ7 A;  5JGS B;  1JCZ A;  4Q0L A;  3RYY A;  1FSR A;  3DC9 A;  4WR7 A;  3ML2 A;  5FLQ A;  4YGL A;  3MDZ A;  5AMD A;  2X7U A;  4QJO A;  1YDC A;  3P3H A;  1UGF A;  1LG6 A;  1I9L A;  4MDG A;  1BNW A;  5G01 A;  1FR7 A;  4RFC A;  3MZC A;  1HEA A;  4FIK A;  3RZ1 B;  4FPT A;  2EU2 A;  3R16 A;  1Z93 A;  3DVC A;  4YXO A;  1CCS A;  4RIU A;  2GEH A;  4ZWZ A;  3IBL A;  2O4Z A;  3OKV A;  3RYV B;  5G0C A;  3S78 B;  5JEH B;  2NXT A;  3B4F A;  3MNH A;  3FFP X;  3V3F A;  4KP5 A;  3KWA A;  3UYN A;  3MHC A;  3OY0 A;  2NN1 A;  3MHO A;  2Q1Q A;  1CVE A;  4WL4 A;  4Q6E A;  3D92 A;  5SZ5 A;  4N16 A;  2HD6 A;  5DSP A;  3W6I A;  4KNM A;  1RZA A;  2X7T A;  4X5S A;  3F7U A;  4Q87 A;  1FSN A;  2W2J A;  4MDL A;  4YGF A;  5EHW A;  9CA2 A;  2CBB A;  1CAM A;  4M2R A;  4KUV A;  4HEZ A;  1BNM A;  5DSN A;  3HKT A;  3V7X A;  4HU1 A;  2AX2 A;  4YGN A;  2NNS A;  3DCC A;  3JXH C;  1I91 A;  4JSZ A;  3PJJ A;  4Z1N A;  3M98 A;  4QJ0 A;  4WUP A;  5HPJ A;  1TTM A;  5E2R A;  5DSJ A;  3F4X A;  3QYK A;  4FL7 A;  3V3G B;  3B1B A;  4G0C A;  5DSO A;  3RZ7 A;  1LGD A;  3JXF A;  5G0B A;  1TG9 A;  1HCB A;  4RN4 A;  1CRA A;  5SZ7 A;  1CCT A;  5C8I A;  5FNI A;  4HEW A;  5DRS A;  1CNB A;  2CA2 A;  5E5R A;  5DSI A;  3S76 A;  4Q08 A;  4MDM A;  2QP6 A;  3IEO A;  3SAP A;  4E4A A;  1BNN A;  3MNA A;  1YDD A;  2NWZ A;  1RZC A;  5JG5 B;  3M1K A;  1G46 A;  4MLT A;  4QJP A;  4XZ5 A;  1JV0 A;  4RUX A;  3MNJ A;  2POW A;  5J8Z A;  1KOP A;  3VBD A;  3M96 A;  2POV A;  1XEG A;  1URT A;  1HUH A;  1CNY A;  4QJM A;  4MLX A;  4QSB A;  2EU3 A;  3BL1 A;  3OIM A;  4Z0Q A;  4QSI A;  1FLJ A;  1ZSA A;  5JDV B;  3T83 A;  3DD8 A;  1CAY A;  4ZX0 A;  1HVA A;  3MHL A;  5EHE A;  3KS3 A;  4FU5 A;  1CAI A;  1G3Z A;  4YGJ A;  3U47 A;  3KKX A;  1T9N A;  3DC3 A;  3K34 A;  1TBT X;  1ZH9 A;  5L6K A;  4QTL A;  5JQ0 A;  1CAO A;  1RAY A;  2QOA A;  4LHI A;  3RJ7 A;  3EFT A;  1RZB A;  1Z97 A;  5LMD A;  4FVN A;  1CVF A;  1XQ0 A;  1UGB A;  3P3J A;  3P5A A;  1YDA A;  4YX4 A;  5DSM A;  5FNH A;  5SZ3 A;  1BIC A;  3M1Q A;  3FW3 A;  3M1W A;  1CZM A;  4Z1E A;  1Z9Y A;  3KOI A;  2NNO A;  4ZWX A;  1TG3 A;  5EIJ A;  2OSF A;  3MNI A;  1CCU A;  4YXI A;  4YHA A;  4XIW A;  3HKU A;  4Q81 A;  1RZD A;  3IBN A;  4KNJ A;  1Y7W A;  5FLS A;  1H4N A;  2AW1 A;  4Q8X A;  1ZSB A;  4FVO A;  1TH9 A;  3P5L A;  4LU3 A;  3TVO X;  1YO1 A;  2FNK A;  1THK A;  4M2U A;  1YO0 A;  5BRW A;  2NWY A;  3U3A X;  4YXU A;  3V5G A;  5EHV A;  12CA A;  3DD0 A;  4PXX A;  1CNC A;  4JSW A;  3DA2 A;  4KUY A;  3D0N A;  2H4N A;  3KLD B;  2FNN A;  2FW4 A;  1KWR A;  5DSL A;  1MOO A;  4CQ0 A;  1I9Q A;  1BN4 A;  1HUG A;  2H15 A;  1ZGE A;  4Z1K A;  4KUW A;  7CA2 A;  5L3O A;  4YWP A;  4R59 A;  4Q6D A;  3U45 X;  5EOI A;  3C7P A;  1BNU A;  1UGG A;  6CA2 A;  4N0X B;  1HEC A;  3RYJ B;  4YGK A;  3IBI A;  5DOH A;  4YVY A;  3S71 B;  4HEY A;  5CA2 A;  4HBA A;  2POU A;  3Q31 A;  5CLU A;  1DCA A;  1KOQ A;  3LXE A;  4CA2 A;  3V3I B;  2FMG A;  4RH2 A;  4PYY A;  1BNT A;  1CNH A;  4KNI A;  1CNJ A;  1G45 A;  1RZE A;  5FLR A;  3IBU A;  1CAJ A; 
#chains in the Genus database with same CATH topology
 5G03 A;  4R5B A;  2WEG A;  4CNX A;  1CAK A;  3K2F A;  1CVC A;  1TE3 X;  4Q9Y A;  2CBA A;  1OKL A;  4QK1 A;  8CA2 A;  4BCW A;  2ILI A;  1G6V A;  3CYU A;  4ITO A;  4CAC A;  1XEV A;  5A6H A;  3DAZ A;  3M1J A;  4CNV A;  2QO8 A;  3P4V A;  2NNV A;  2VVA X;  3W6H A;  3L14 A;  5DOG A;  4JSS A;  4QK2 A;  5JES B;  3M67 A;  3PO6 A;  1A42 A;  1I90 A;  4K0T A;  1CIM A;  2F14 A;  3F7B A;  1CAL A;  5FNM A;  1YO2 A;  3HS4 A;  4KNN A;  1IF6 A;  2HNC A;  1CA2 A;  3DCS A;  4GL1 X;  1LZV A;  4E5Q A;  1HED A;  1F2W A;  4YYT A;  1CNX A;  1LUG A;  1BNQ A;  5FLT A;  4RUZ A;  3SBI A;  3GZ0 A;  1CAH A;  1CA3 A;  3S97 A;  2CBC A;  3S77 B;  3SAX A;  5DSQ A;  5SZ2 A;  2NMX A;  3RLD A;  2NNG A;  1RJ6 A;  4HT2 A;  1BV3 A;  2NN7 A;  4Q90 A;  3KNE A;  4WW8 A;  4M2V A;  5SZ1 A;  2FOY A;  3RYX B;  4MO8 A;  3DCW A;  2HFW A;  2WEO A;  5FNL A;  4QIY A;  3HLJ A;  2Q38 A;  4XFW A;  5DSR A;  4C3T A;  5BRU A;  4TWL A;  5CAC A;  3P44 A;  3OYQ A;  5E2M A;  1FR4 A;  1IF5 A;  1ZFK A;  1DCB A;  3MHI A;  4QSA A;  1CIL A;  4L5V A;  4PZH A;  5SZ4 A;  3RG3 A;  4ZWI A;  4E9O X;  4HT0 A;  1CVD A;  5EKM A;  2NWO A;  3RZ5 A;  1G0F A;  5EZT X;  3M2Y A;  1TB0 X;  4E3D A;  1RAZ A;  1G1D A;  5EH8 A;  5FL5 A;  3P58 A;  3S9T A;  1YDB A;  5FNG A;  2ABE A;  4ILX A;  2FOV A;  1CVH A;  4CNW A;  4Q7V A;  3JXG A;  3T5U A;  2NXR A;  3S75 B;  3M5S A;  3M40 A;  1G48 A;  4PQ7 A;  2HL4 A;  1MUA A;  1ZSC A;  1CNW A;  1IF9 A;  5JGT B;  2HOC A;  3MWO A;  3NJ9 A;  3V2J A;  2NXS A;  1OKN A;  1KWQ A;  4LP6 A;  1FQL A;  1ZFQ A;  4KP8 A;  5DVX A;  4Q99 A;  5FL6 A;  4QJX A;  4IWZ A;  3MHM A;  3M2N A;  4CNR A;  1IF8 A;  3DV7 A;  5JEP B;  2CBD A;  3CZV A;  3DBU A;  3HKN A;  3M5T A;  4QK3 A;  2FNM A;  2FOS A;  1AVN A;  3KON A;  2CBE A;  4Q8Z A;  1FQR A;  4QSJ A;  1G4O A;  4KAP A;  5FNK A;  1H9Q A;  2ZNC A;  1FQN A;  4M2W A;  1IF7 A;  1ZNC A;  3M04 A;  3N3J A;  1G52 A;  1TEQ X;  5FLP A;  4RFD A;  4K13 A;  5SZ0 A;  4QIZ A;  3D8W A;  4ETQ C;  2X7S A;  4Q06 A;  2WD2 A;  1ZGF A;  4JSA A;  3ML5 A;  4KV0 A;  4E3G A;  1UGC A;  5FNJ A;  1BZM A;  1CRM A;  5E2N A;  1G4J A;  4FRC A;  1J9W A;  3F8E A;  3M3X A;  3RZ0 B;  4DZ9 A;  4RUY A;  5EH5 A;  1I8Z A;  4QEF A;  3OIK A;  4ZWY A;  3S74 B;  3S72 B;  4K1Q A;  1XPZ A;  3T85 A;  4Q7P A;  3T84 A;  3N0N A;  1BNV A;  4Q49 A;  1RJ5 A;  5EKH A;  3V2M A;  4E3F A;  3ZNC A;  5FL4 A;  1CVB A;  1IF4 A;  1AM6 A;  1CAN A;  2CAB A;  3CA2 A;  4Q7S A;  3ZP9 A;  2FMZ A;  4TWM A;  3P55 A;  3T82 A;  3M2X A;  2NWP A;  4BF6 A;  5E2S A;  5FLO A;  5BNL A;  1I9O A;  4MTY A;  3HKQ A;  1CAZ A;  1UGA A;  2WEH A;  1UGD A;  3NI5 A;  1UGE A;  1DMY A;  3CAJ A;  4XIX A;  5JEG B;  3K7K A;  1CNK A;  1G54 A;  5A25 A;  3M5E A;  5EH7 A;  3V3J A;  5FDC A;  4JS6 A;  3RG4 A;  5IPZ A;  3FE4 A;  5AMG A;  4ZX1 A;  2GD8 A;  1TEU X;  4Y0J A;  1FQM A;  5E2K A;  4E3H A;  3EFI A;  1AZM A;  2WD3 A;  4XE1 A;  1CNI A;  4DZ7 A;  1DMX A;  1ZE8 A;  1KEQ A;  3MYQ A;  2HKK A;  1H9N A;  3OKU A;  3UYQ A;  4WUQ A;  1CNG A;  4R5A A;  1OQ5 A;  1OKM A;  5SZ6 A;  3MNU A;  1V9I C;  1BN3 A;  1G0E A;  2FOQ A;  3MNK A;  3N2P A;  1LG5 A;  4G7A A;  4Q78 A;  4WW6 A;  3D9Z A;  1HCA A;  5BRV A;  3S8X A;  3SBH A;  3OIL A;  1CVA A;  3BL0 A;  1I9M A;  3R17 B;  4HF3 A;  5E5U A;  3DVB A;  1V9E A;  3KOK A;  1EOU A;  3NB5 A;  4RIV A;  4ZAO A;  3RYZ A;  1JD0 A;  3T5Z A;  3IGP A;  5JG3 B;  4UOV A;  5EKJ A;  4K0S A;  2WEJ A;  1I9N A;  2IT4 A;  4L5U A;  4IDR X;  4E49 A;  3TVN X;  3RZ8 A;  1I9P A;  5DSK A;  4Q83 A;  4Q8Y A;  2VVB X;  5E28 A;  4QY3 A;  4BF1 A;  3N4B A;  4COQ A;  2Q1B A;  4Q7W A;  4Z1J A;  3PYK A;  5BYI A;  3D93 A;  4ITP A;  5CJF A;  3HFP A;  2FOU A;  3IAI A;  4Q09 A;  1FSQ A;  1CIN A;  5FDI A;  5JQT A;  3S73 B;  3OYS A;  4K0Z A;  1G53 A;  1HEB A;  3V3H B;  3DVD A;  3MMF A;  3U7C A;  5AML A;  4PYX A;  2OSM A;  3KIG A;  1BCD A;  3TMJ A;  3BET A;  4Q07 A;  3M14 A;  4QJW A;  4L5W A;  3RGE A;  3M2Z A;  1BN1 A;  2EZ7 A;  5JGS B;  1JCZ A;  4Q0L A;  3RYY A;  1FSR A;  3DC9 A;  4WR7 A;  3ML2 A;  5FLQ A;  4YGL A;  3MDZ A;  5AMD A;  2X7U A;  4QJO A;  1YDC A;  3P3H A;  1UGF A;  1LG6 A;  1I9L A;  4MDG A;  1BNW A;  5G01 A;  1FR7 A;  4RFC A;  3MZC A;  1HEA A;  4FIK A;  3RZ1 B;  4FPT A;  2EU2 A;  3R16 A;  1Z93 A;  3DVC A;  4YXO A;  1CCS A;  4RIU A;  2GEH A;  4ZWZ A;  3IBL A;  2O4Z A;  3OKV A;  3RYV B;  5G0C A;  3S78 B;  5JEH B;  2NXT A;  3B4F A;  3MNH A;  3FFP X;  3V3F A;  4KP5 A;  3KWA A;  3UYN A;  3MHC A;  3OY0 A;  2NN1 A;  3MHO A;  2Q1Q A;  1CVE A;  4WL4 A;  4Q6E A;  3D92 A;  5SZ5 A;  4N16 A;  2HD6 A;  5DSP A;  3W6I A;  4KNM A;  1RZA A;  2X7T A;  4X5S A;  3F7U A;  4Q87 A;  1FSN A;  2W2J A;  4MDL A;  4YGF A;  5EHW A;  9CA2 A;  2CBB A;  1CAM A;  4M2R A;  4KUV A;  4HEZ A;  1BNM A;  5DSN A;  3HKT A;  3V7X A;  4HU1 A;  2AX2 A;  4YGN A;  2NNS A;  3DCC A;  3JXH C;  1I91 A;  4JSZ A;  3PJJ A;  4Z1N A;  3M98 A;  4QJ0 A;  4WUP A;  5HPJ A;  1TTM A;  5E2R A;  5DSJ A;  3F4X A;  3QYK A;  4FL7 A;  3V3G B;  3B1B A;  4G0C A;  5DSO A;  3RZ7 A;  1LGD A;  3JXF A;  5G0B A;  1TG9 A;  1HCB A;  4RN4 A;  1CRA A;  5SZ7 A;  1CCT A;  5C8I A;  5FNI A;  4HEW A;  5DRS A;  1CNB A;  2CA2 A;  5E5R A;  5DSI A;  3S76 A;  4Q08 A;  4MDM A;  2QP6 A;  3IEO A;  3SAP A;  4E4A A;  1BNN A;  3MNA A;  1YDD A;  2NWZ A;  1RZC A;  5JG5 B;  3M1K A;  1G46 A;  4MLT A;  4QJP A;  4XZ5 A;  1JV0 A;  4RUX A;  3MNJ A;  2POW A;  5J8Z A;  1KOP A;  3VBD A;  3M96 A;  2POV A;  1XEG A;  1URT A;  1HUH A;  1CNY A;  4QJM A;  4MLX A;  4QSB A;  2EU3 A;  3BL1 A;  3OIM A;  4Z0Q A;  4QSI A;  1FLJ A;  1ZSA A;  5JDV B;  3T83 A;  3DD8 A;  1CAY A;  4ZX0 A;  1HVA A;  3MHL A;  5EHE A;  3KS3 A;  4FU5 A;  1CAI A;  1G3Z A;  4YGJ A;  3U47 A;  3KKX A;  1T9N A;  3DC3 A;  3K34 A;  1TBT X;  1ZH9 A;  5L6K A;  4QTL A;  5JQ0 A;  1CAO A;  1RAY A;  2QOA A;  4LHI A;  3RJ7 A;  3EFT A;  1RZB A;  1Z97 A;  5LMD A;  4FVN A;  1CVF A;  1XQ0 A;  1UGB A;  3P3J A;  3P5A A;  1YDA A;  4YX4 A;  5DSM A;  5FNH A;  5SZ3 A;  1BIC A;  3M1Q A;  3FW3 A;  3M1W A;  1CZM A;  4Z1E A;  1Z9Y A;  3KOI A;  2NNO A;  4ZWX A;  1TG3 A;  5EIJ A;  2OSF A;  3MNI A;  1CCU A;  4YXI A;  4YHA A;  4XIW A;  3HKU A;  4Q81 A;  1RZD A;  3IBN A;  4KNJ A;  1Y7W A;  5FLS A;  1H4N A;  2AW1 A;  4Q8X A;  1ZSB A;  4FVO A;  1TH9 A;  3P5L A;  4LU3 A;  3TVO X;  1YO1 A;  2FNK A;  1THK A;  4M2U A;  1YO0 A;  5BRW A;  2NWY A;  3U3A X;  4YXU A;  3V5G A;  5EHV A;  12CA A;  3DD0 A;  4PXX A;  1CNC A;  4JSW A;  3DA2 A;  4KUY A;  3D0N A;  2H4N A;  3KLD B;  2FNN A;  2FW4 A;  1KWR A;  5DSL A;  1MOO A;  4CQ0 A;  1I9Q A;  1BN4 A;  1HUG A;  2H15 A;  1ZGE A;  4Z1K A;  4KUW A;  7CA2 A;  5L3O A;  4YWP A;  4R59 A;  4Q6D A;  3U45 X;  5EOI A;  3C7P A;  1BNU A;  1UGG A;  6CA2 A;  4N0X B;  1HEC A;  3RYJ B;  4YGK A;  3IBI A;  5DOH A;  4YVY A;  3S71 B;  4HEY A;  5CA2 A;  4HBA A;  2POU A;  3Q31 A;  5CLU A;  1DCA A;  1KOQ A;  3LXE A;  4CA2 A;  3V3I B;  2FMG A;  4RH2 A;  4PYY A;  1BNT A;  1CNH A;  4KNI A;  1CNJ A;  1G45 A;  1RZE A;  5FLR A;  3IBU A;  1CAJ A; 
#chains in the Genus database with same CATH homology
 5G03 A;  4R5B A;  2WEG A;  4CNX A;  1CAK A;  3K2F A;  1CVC A;  1TE3 X;  4Q9Y A;  2CBA A;  1OKL A;  4QK1 A;  8CA2 A;  4BCW A;  2ILI A;  1G6V A;  3CYU A;  4ITO A;  4CAC A;  1XEV A;  5A6H A;  3DAZ A;  3M1J A;  4CNV A;  2QO8 A;  3P4V A;  2NNV A;  2VVA X;  3W6H A;  3L14 A;  5DOG A;  4JSS A;  4QK2 A;  5JES B;  3M67 A;  3PO6 A;  1A42 A;  1I90 A;  4K0T A;  1CIM A;  2F14 A;  3F7B A;  1CAL A;  5FNM A;  1YO2 A;  3HS4 A;  4KNN A;  1IF6 A;  2HNC A;  1CA2 A;  3DCS A;  4GL1 X;  1LZV A;  4E5Q A;  1HED A;  1F2W A;  4YYT A;  1CNX A;  1LUG A;  1BNQ A;  5FLT A;  4RUZ A;  3SBI A;  3GZ0 A;  1CAH A;  1CA3 A;  3S97 A;  2CBC A;  3S77 B;  3SAX A;  5DSQ A;  5SZ2 A;  2NMX A;  3RLD A;  2NNG A;  1RJ6 A;  4HT2 A;  1BV3 A;  2NN7 A;  4Q90 A;  3KNE A;  4WW8 A;  4M2V A;  5SZ1 A;  2FOY A;  3RYX B;  4MO8 A;  3DCW A;  2HFW A;  2WEO A;  5FNL A;  4QIY A;  3HLJ A;  2Q38 A;  4XFW A;  5DSR A;  4C3T A;  5BRU A;  4TWL A;  5CAC A;  3P44 A;  3OYQ A;  5E2M A;  1FR4 A;  1IF5 A;  1ZFK A;  1DCB A;  3MHI A;  4QSA A;  1CIL A;  4L5V A;  4PZH A;  5SZ4 A;  3RG3 A;  4ZWI A;  4E9O X;  4HT0 A;  1CVD A;  5EKM A;  2NWO A;  3RZ5 A;  1G0F A;  5EZT X;  3M2Y A;  1TB0 X;  4E3D A;  1RAZ A;  1G1D A;  5EH8 A;  5FL5 A;  3P58 A;  3S9T A;  1YDB A;  5FNG A;  2ABE A;  4ILX A;  2FOV A;  1CVH A;  4CNW A;  4Q7V A;  3JXG A;  3T5U A;  2NXR A;  3S75 B;  3M5S A;  3M40 A;  1G48 A;  4PQ7 A;  2HL4 A;  1MUA A;  1ZSC A;  1CNW A;  1IF9 A;  5JGT B;  2HOC A;  3MWO A;  3NJ9 A;  3V2J A;  2NXS A;  1OKN A;  1KWQ A;  4LP6 A;  1FQL A;  1ZFQ A;  4KP8 A;  5DVX A;  4Q99 A;  5FL6 A;  4QJX A;  4IWZ A;  3MHM A;  3M2N A;  4CNR A;  1IF8 A;  3DV7 A;  5JEP B;  2CBD A;  3CZV A;  3DBU A;  3HKN A;  3M5T A;  4QK3 A;  2FNM A;  2FOS A;  1AVN A;  3KON A;  2CBE A;  4Q8Z A;  1FQR A;  4QSJ A;  1G4O A;  4KAP A;  5FNK A;  1H9Q A;  2ZNC A;  1FQN A;  4M2W A;  1IF7 A;  1ZNC A;  3M04 A;  3N3J A;  1G52 A;  1TEQ X;  5FLP A;  4RFD A;  4K13 A;  5SZ0 A;  4QIZ A;  3D8W A;  4ETQ C;  2X7S A;  4Q06 A;  2WD2 A;  1ZGF A;  4JSA A;  3ML5 A;  4KV0 A;  4E3G A;  1UGC A;  5FNJ A;  1BZM A;  1CRM A;  5E2N A;  1G4J A;  4FRC A;  1J9W A;  3F8E A;  3M3X A;  3RZ0 B;  4DZ9 A;  4RUY A;  5EH5 A;  1I8Z A;  4QEF A;  3OIK A;  4ZWY A;  3S74 B;  3S72 B;  4K1Q A;  1XPZ A;  3T85 A;  4Q7P A;  3T84 A;  3N0N A;  1BNV A;  4Q49 A;  1RJ5 A;  5EKH A;  3V2M A;  4E3F A;  3ZNC A;  5FL4 A;  1CVB A;  1IF4 A;  1AM6 A;  1CAN A;  2CAB A;  3CA2 A;  4Q7S A;  3ZP9 A;  2FMZ A;  4TWM A;  3P55 A;  3T82 A;  3M2X A;  2NWP A;  4BF6 A;  5E2S A;  5FLO A;  5BNL A;  1I9O A;  4MTY A;  3HKQ A;  1CAZ A;  1UGA A;  2WEH A;  1UGD A;  3NI5 A;  1UGE A;  1DMY A;  3CAJ A;  4XIX A;  5JEG B;  3K7K A;  1CNK A;  1G54 A;  5A25 A;  3M5E A;  5EH7 A;  3V3J A;  5FDC A;  4JS6 A;  3RG4 A;  5IPZ A;  3FE4 A;  5AMG A;  4ZX1 A;  2GD8 A;  1TEU X;  4Y0J A;  1FQM A;  5E2K A;  4E3H A;  3EFI A;  1AZM A;  2WD3 A;  4XE1 A;  1CNI A;  4DZ7 A;  1DMX A;  1ZE8 A;  1KEQ A;  3MYQ A;  2HKK A;  1H9N A;  3OKU A;  3UYQ A;  4WUQ A;  1CNG A;  4R5A A;  1OQ5 A;  1OKM A;  5SZ6 A;  3MNU A;  1V9I C;  1BN3 A;  1G0E A;  2FOQ A;  3MNK A;  3N2P A;  1LG5 A;  4G7A A;  4Q78 A;  4WW6 A;  3D9Z A;  1HCA A;  5BRV A;  3S8X A;  3SBH A;  3OIL A;  1CVA A;  3BL0 A;  1I9M A;  3R17 B;  4HF3 A;  5E5U A;  3DVB A;  1V9E A;  3KOK A;  1EOU A;  3NB5 A;  4RIV A;  4ZAO A;  3RYZ A;  1JD0 A;  3T5Z A;  3IGP A;  5JG3 B;  4UOV A;  5EKJ A;  4K0S A;  2WEJ A;  1I9N A;  2IT4 A;  4L5U A;  4IDR X;  4E49 A;  3TVN X;  3RZ8 A;  1I9P A;  5DSK A;  4Q83 A;  4Q8Y A;  2VVB X;  5E28 A;  4QY3 A;  4BF1 A;  3N4B A;  4COQ A;  2Q1B A;  4Q7W A;  4Z1J A;  3PYK A;  5BYI A;  3D93 A;  4ITP A;  5CJF A;  3HFP A;  2FOU A;  3IAI A;  4Q09 A;  1FSQ A;  1CIN A;  5FDI A;  5JQT A;  3S73 B;  3OYS A;  4K0Z A;  1G53 A;  1HEB A;  3V3H B;  3DVD A;  3MMF A;  3U7C A;  5AML A;  4PYX A;  2OSM A;  3KIG A;  1BCD A;  3TMJ A;  3BET A;  4Q07 A;  3M14 A;  4QJW A;  4L5W A;  3RGE A;  3M2Z A;  1BN1 A;  2EZ7 A;  5JGS B;  1JCZ A;  4Q0L A;  3RYY A;  1FSR A;  3DC9 A;  4WR7 A;  3ML2 A;  5FLQ A;  4YGL A;  3MDZ A;  5AMD A;  2X7U A;  4QJO A;  1YDC A;  3P3H A;  1UGF A;  1LG6 A;  1I9L A;  4MDG A;  1BNW A;  5G01 A;  1FR7 A;  4RFC A;  3MZC A;  1HEA A;  4FIK A;  3RZ1 B;  4FPT A;  2EU2 A;  3R16 A;  1Z93 A;  3DVC A;  4YXO A;  1CCS A;  4RIU A;  2GEH A;  4ZWZ A;  3IBL A;  2O4Z A;  3OKV A;  3RYV B;  5G0C A;  3S78 B;  5JEH B;  2NXT A;  3B4F A;  3MNH A;  3FFP X;  3V3F A;  4KP5 A;  3KWA A;  3UYN A;  3MHC A;  3OY0 A;  2NN1 A;  3MHO A;  2Q1Q A;  1CVE A;  4WL4 A;  4Q6E A;  3D92 A;  5SZ5 A;  4N16 A;  2HD6 A;  5DSP A;  3W6I A;  4KNM A;  1RZA A;  2X7T A;  4X5S A;  3F7U A;  4Q87 A;  1FSN A;  2W2J A;  4MDL A;  4YGF A;  5EHW A;  9CA2 A;  2CBB A;  1CAM A;  4M2R A;  4KUV A;  4HEZ A;  1BNM A;  5DSN A;  3HKT A;  3V7X A;  4HU1 A;  2AX2 A;  4YGN A;  2NNS A;  3DCC A;  3JXH C;  1I91 A;  4JSZ A;  3PJJ A;  4Z1N A;  3M98 A;  4QJ0 A;  4WUP A;  5HPJ A;  1TTM A;  5E2R A;  5DSJ A;  3F4X A;  3QYK A;  4FL7 A;  3V3G B;  3B1B A;  4G0C A;  5DSO A;  3RZ7 A;  1LGD A;  3JXF A;  5G0B A;  1TG9 A;  1HCB A;  4RN4 A;  1CRA A;  5SZ7 A;  1CCT A;  5C8I A;  5FNI A;  4HEW A;  5DRS A;  1CNB A;  2CA2 A;  5E5R A;  5DSI A;  3S76 A;  4Q08 A;  4MDM A;  2QP6 A;  3IEO A;  3SAP A;  4E4A A;  1BNN A;  3MNA A;  1YDD A;  2NWZ A;  1RZC A;  5JG5 B;  3M1K A;  1G46 A;  4MLT A;  4QJP A;  4XZ5 A;  1JV0 A;  4RUX A;  3MNJ A;  2POW A;  5J8Z A;  1KOP A;  3VBD A;  3M96 A;  2POV A;  1XEG A;  1URT A;  1HUH A;  1CNY A;  4QJM A;  4MLX A;  4QSB A;  2EU3 A;  3BL1 A;  3OIM A;  4Z0Q A;  4QSI A;  1FLJ A;  1ZSA A;  5JDV B;  3T83 A;  3DD8 A;  1CAY A;  4ZX0 A;  1HVA A;  3MHL A;  5EHE A;  3KS3 A;  4FU5 A;  1CAI A;  1G3Z A;  4YGJ A;  3U47 A;  3KKX A;  1T9N A;  3DC3 A;  3K34 A;  1TBT X;  1ZH9 A;  5L6K A;  4QTL A;  5JQ0 A;  1CAO A;  1RAY A;  2QOA A;  4LHI A;  3RJ7 A;  3EFT A;  1RZB A;  1Z97 A;  5LMD A;  4FVN A;  1CVF A;  1XQ0 A;  1UGB A;  3P3J A;  3P5A A;  1YDA A;  4YX4 A;  5DSM A;  5FNH A;  5SZ3 A;  1BIC A;  3M1Q A;  3FW3 A;  3M1W A;  1CZM A;  4Z1E A;  1Z9Y A;  3KOI A;  2NNO A;  4ZWX A;  1TG3 A;  5EIJ A;  2OSF A;  3MNI A;  1CCU A;  4YXI A;  4YHA A;  4XIW A;  3HKU A;  4Q81 A;  1RZD A;  3IBN A;  4KNJ A;  1Y7W A;  5FLS A;  1H4N A;  2AW1 A;  4Q8X A;  1ZSB A;  4FVO A;  1TH9 A;  3P5L A;  4LU3 A;  3TVO X;  1YO1 A;  2FNK A;  1THK A;  4M2U A;  1YO0 A;  5BRW A;  2NWY A;  3U3A X;  4YXU A;  3V5G A;  5EHV A;  12CA A;  3DD0 A;  4PXX A;  1CNC A;  4JSW A;  3DA2 A;  4KUY A;  3D0N A;  2H4N A;  3KLD B;  2FNN A;  2FW4 A;  1KWR A;  5DSL A;  1MOO A;  4CQ0 A;  1I9Q A;  1BN4 A;  1HUG A;  2H15 A;  1ZGE A;  4Z1K A;  4KUW A;  7CA2 A;  5L3O A;  4YWP A;  4R59 A;  4Q6D A;  3U45 X;  5EOI A;  3C7P A;  1BNU A;  1UGG A;  6CA2 A;  4N0X B;  1HEC A;  3RYJ B;  4YGK A;  3IBI A;  5DOH A;  4YVY A;  3S71 B;  4HEY A;  5CA2 A;  4HBA A;  2POU A;  3Q31 A;  5CLU A;  1DCA A;  1KOQ A;  3LXE A;  4CA2 A;  3V3I B;  2FMG A;  4RH2 A;  4PYY A;  1BNT A;  1CNH A;  4KNI A;  1CNJ A;  1G45 A;  1RZE A;  5FLR A;  3IBU A;  1CAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...