9DWSA

X-ray crystal structure of francisella hispaniensis apo ribonucleotide reductase beta subunit
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
289
structure length
289
Chain Sequence
SLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVAVGQNYYDQFIPLFKNNEVRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLCLAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAVELEDKFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Structurally Divergent Class Ia Ribonucleotide Reductase from a Tick-Borne Pathogen.
pubmed doi rcsb
molecule keywords ribonucleoside-diphosphate reductase
molecule tags Oxidoreductase
source organism Francisella hispaniensis
total genus 130
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 1.17.4.1: ribonucleoside-diphosphate reductase.
pdb deposition date 2024-10-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...