9GXCA

Room temperature structure of fad-containing ferrodoxin-nadp reductase from brucella ovis at lcls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
257
structure length
257
Chain Sequence
SSNFNQETVTDIHHWTDTLFSFRTTRDPGFRFQSGQFIMMGLEVNGKPLTRAYSIASSLYEDGLEFFSIKVPNGPLTSKLQHLKKGDQIIVSKKPVGTLLYDNLKPGKHLWLLSTGTGLAPFLSIIRDLEVYERFEKVILVHGVRQVAELAYTDFISNELPQDEFLGEMVKNQLIYYPTVTREPYKTRGRLTDLIRSGQLFKDVGLPEFNHEDDRMMLCGSPEMLAETKQILEERGFTEGSQSEPGEFVIEKAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into the function and molecular mechanisms of Ferredoxin-NADP + reductase from Brucella ovis.
pubmed doi rcsb
molecule keywords ferredoxin--NADP(+) reductase
molecule tags Oxidoreductase
source organism Brucella ovis atcc 25840
total genus 85
structure length 257
sequence length 257
ec nomenclature ec 1.18.1.2: ferredoxin--NADP(+) reductase.
pdb deposition date 2024-09-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...