9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
3RC2A 4OOEA 3DBRB 5JLAA 4RPKA 4CUKA 5ILOA 3OIGA 1U3WA 1LLDA 4YT5A 4R3NA 3FN4A 3TQHA 4AJPA 3FI9A 5IN5A 1R4NA 3Q9UA 4XDYA 2G17A 4JP2A 5F1OA 4RLHA 3TN7A 1XIVA 3BYZA 4RVGA 4Z9XA 4JN6B 1W8DA 5U4QA 2ZTUA 1N9GA 3S1LA 3UGKA 3LU1A 4PRKA 1QYDA 5T8KC 1Y6JA 5JW6A 3TWOA 4OSOA 3U49A 4YJDA 2VYNA 1BVUA 3JQBA 1LSUA 1E5QA 1HDOA 4I08A 5KJ6A 3H5AA 1P0FA 3JD3A 1PGQA 4WJZA 2ZYAA 2J5QA 5L95A 1ADBA 3JD2A 3WYCA 1B14A 3SC4A 4BUCA 3QIVA 3UFXA 3OMLA 1VI2A 3DWFA 3UKOA 4FW8A 2O2SA 4BNVA 4LISA 1OC2A 2DLDA 2P9CA 3OJLA 4WLUA 2AW5A 3PWSA 3RUFA 1NAHA 3Q6IA 3HG7A 3SX2A 1F8GA 1UUFA 3K73O 3UF0A 1OC4A 5JPIA 1IZ0A 1IPEA 3H9JA 3TF5A 1EEHA 1XU9A 3ADOA 4L9RA 2EERA 2CFCA 3QW2A 4Y8VA 1XA0A 4MKXA 5FF9A 1GQYA 3DBHA 5CHEA 1ZK3A 1YOVA 3HDYA 3RQSA 4P8RA 4U7WA 4UVDA 3JQFC 1E6EA 3NUGA 1W73A 1DRUA 1YXMA 2O23A 5K6AA 4WNIA 3KHUA 4PZEA 1U4SA 2A4KA 2O2YA 3BHIA 3DZIA 3VVBA 1CJCA 4MJLA 5THQA 5ENVA 5HWSA 4CLXA 1H9BA 2PV7A 4N5LA 4E5NA 3MWEB 1GZ3A 4BMSA 4ALKA 2NTJA 1QSGA 2VUSA 3AI1A 1NXQA 4U6SA 1Z74A 1I3KA 3OQ6A 1CDOA 1NHWA 3FR7A 2Q49A 3CPSA 3H5NA 3PQEA 4XDZA 2XOXA 1A72A 1G6KA 4YEDA 5TJHA 4YJHA 3ROQA 4UAGA 3M1AA 3HQ4O 1AE1A 3EY4A 4BNXA 3LT4A 3JQAA 1LI4A 2DBZA 4DPKA 4BO4A 2DUWA 3A06A 5JCXA 4LK3A 2Y0CA 2O3TA 1WXDA 5A05A 3PWZA 2IZ0A 5A06A 1NQTA 3AM3A 1IB6A 4B79A 2OHXA 3BIOA 2NVBA 1GEGA 2X0NA 1PS9A 4ZA2A 1DSSG 3CXRA 4GMFA 3V8BA 4IDGA 1U3VA 2VUUA 1L1FA 1NQOA 4R16A 1SMKA 5IN4A 1ZK2A 3ROPA 2Y66A 2B35A 1ZBQA 3RU7A 2FN7A 4HY3A 3ZWCA 4RQUA 3JQEA 4GLLA 4PGFA 3FWZA 5IZ4A 1EK6A 1QV7A 1V6AA 4FOOA 3GVPA 4BO0A 1LLUA 4AJJA 3GHYA 2IZZA 2PGJA 3PHHA 3VPXA 1GYPA 4QTZA 5ILGA 3LK7A 3DHNA 5A9RA 1IHYA 3S2FA 4UREA 4P22A 1HL3A 1E77A 3GFGA 3NDIA 4CQLA 4XWYA 1D8AA 2OUIA 4IUYA 1OBFO 3AK4A 4RF4A 2OXIA 1PJTA 3LQFA 3TOXA 4YJFA 2V65A 3LYLA 3OSUA 5HS4A 4YAIA 4NJMB 5KIAA 4RVDA 3MEQA 5EQDA 4BNHA 4L74A 2VWGA 2GDZA 1HDCA 1NBOA 3RUAA 3Q9NA 4BNTA 4LCJA 2O3UA 2O3JA 1DC6A 3HDHA 3PEFA 3G49A 3PHLA 1I01A 7ADHA 4OH1A 1V3UA 1E1NA 2I65A 1UXGA 3OF2A 4IBOA 4TZTA 5MDHA 1D3AA 4ND2A 1LTHR 3VTFA 4CMGA 1QV6A 2CDCA 2FPIA 1M76A 1P1IA 3RC9A 2HMVA 5CDYA 5IJZA 3DOCA 4ID9A 3AJRA 3GY0A 4Z0PA 1GYQA 5DCWA 1ULUA 1M6HA 5BSHA 2HAEA 3LZ6A 2O3RA 1LRJA 1HF3A 2PNFA 3S8MA 1ISIA 1CF2O 1JN0A 1SBYA 4RVFA 1VL8A 1OAAA 2QHXA 5AXAA 3ZWNA 3ZNPA 3ETEA 3QE3A 1SOWA 4AFNA 4CLDA 3P7MA 4IINA 4N54A 4W6ZA 3VKUA 4UUMA 4PLFA 5TJ9A 3IP1A 3TZKA 3VZQA 4CLOB 4EJ0A 2AEMA 4CM5A 1MB4A 4J2HA 1YWGO 3GQVA 2FR0A 2VHWA 2WDZA 1N7GA 2GSDA 2OBNA 2NNLD 3P2OA 2WSBA 3B1FA 1N1GA 2C07A 4XJSA 5I9LA 5G0UA 4ONEA 3K2BA 1YBMA 2Q1UA 1H6DA 3PDJA 4ND5A 3LVFO 2GN9A 5L4NA 4K6FA 3D3WB 4BQPA 2GRAA 4RLSA 3DZBA 1HXHA 4ITUA 4LW8A 3ZWAA 2ZJ0A 3LC2O 1LXCA 1XSEA 5KCZA 1H94A 5JMPA 2OOSA 4HFMA 3R0IA 1ZJYA 4R1UA 3HB4X 4LRSB 1X7GA 1TA4A 4KOAA 1P1HA 2JAHA 3WLFA 2PGDA 4MVJP 2H63A 3CMMA 1GCOA 3NGLA 4WEOA 2ZB7A 1Y1PA 4FS3A 3ITDA 1JDJA 2FSSA 2P9EA 2W4QA 3RFVA 4CV2A 1VKNA 3JYPA 4L4XA 2D2IA 4JJGA 4HX5A 4NG5A 4S1VA 2A92A 2BFAA 1DEHA 1PGJA 4AVYA 4AJ2A 3NV9A 3QWBA 3GNTA 4GKVA 1MUUA 1R4MB 1H93A 5IZCC 3O9ZA 5HTOA 3DR3A 1I33A 3PK0A 4NPCA 5EIOA 3U5TA 4RZIA 3CZMA 3WNQA 1ZEJA 3GVHA 2VWPA 4DL9A 2X58A 1BG6A 4JK3A 4FIZA 2VT3A 4X54A 4BOYA 1KEPA 4R1NA 2E37A 1ZK0A 1XQ1A 3KOUA 3GGGA 2OBYA 4ALLA 3L6DA 2DBQA 4IQ8A 1DRVA 4OKNA 4EEXA 3QWFA 3A4VA 2OFPA 2OMEA 3RFTA 3CKYA 5AOVA 3E5RA 4IPTA 4NQZA 1VJ0A 4KTTE 4FC7A 3ENKA 3L9XA 1HSOA 2Z5LA 4AICA 4UEOA 5ES3A 1QG6A 3QVWA 4YRDA 5L40A 4KWIA 1I8TA 1P77A 3NTQA 1E7RA 1LX6A 3DHYA 4BNLA 4R01A 3ST7A 1J4AA 4O5OA 2BELA 3H65A 1GEEA 4WOKA 4HFJA 5DN9A 4J9VA 5TRTA 4NBVA 3WGGA 2WTBA 1ZH8A 3F5SA 3O8QB 4NZ9A 3UCXA 2WMDA 4KMSA 1E7YA 4CMIB 1HE5A 4PZCA 1KVTA 3ZW8A 4FGWA 2HJSA 4I8XA 1W4ZA 3NTRA 3T4XA 3TZCA 3H8VA 4OJNA 2J3KA 3K9QO 2I3GA 1T2AA 3WGZA 1ENZA 3CE6A 2B83A 5DOZA 5I7SA 3IIEA 1P44A 4LGVA 4AL4A 3ZHXA 4FFPA 4YQZA 1LBEA 4AJIA 2DFDA 2FPGA 1ZO8A 3PWKA 5AXBA 3VH1A 1SEPA 4RDIA 1H5QA 4DIBA 4XJTA 3OP4A 1U4OA 2C5AA 2J6IA 1FDSA 1DFHA 4CUJA 4XGIA 3V2UA 1K6XA 3GRKA 2O3QA 4YT4A 1CQIA 5I7FA 1PGNA 1NWCA 5GZ3A 3PGJA 1PJSA 2HDHA 2POQX 5KJEA 4CPDA 2UYYA 3BMQB 1C0LA 3KTDA 1D1TA 1Q2XA 1B8UA 1AHHA 1X14A 3FRJA 3ZU3A 1PEDA 3ZN2A 4BGEA 3FBGA 4PG5A 1YL6A 4JBIA 2YV3A 3JTMA 2EGGA 4MVJD 2B69A 5JDCC 2QX7A 5GZ1A 2NU9A 1UZMA 3PYXA 3VZRA 4RF3A 3VPHA 2Q99A 5G4KB 2Y1FA 4WECA 2NU6A 3IKTA 2YV2A 1QMGA 3RBXA 3ZNOA 1PJCA 4NBWA 4OXNA 1CQJA 3ZCXA 2PH5A 1P9LA 2HK8A 1BSVA 3ADPA 4LSWA 1NWHA 1SPXA 1E3EA 1PWXA 2VWQA 3IKVA 4XYGA 3UICA 1JVSA 3FTPA 1ENYA 3QWAA 4MIOA 1ZMTA 3IQDB 4TROA 5ADHA 2O7QA 3M6IA 3R1IA 1HDZA 4JBHA 3SEFA 2HCTA 4J1QA 4PN3A 1F14A 7MDHA 1R6DA 3LLVA 1C0PA 5JAIA 1LDYA 3QP9A 4R1SA 1U5AA 1X15A 1EUZA 1LQUA 3HADA 4CMHA 4ZRNA 1ZK4A 3OJOA 1SAYA 5HM8A 4BO2A 3ZH2A 1BHSA 1F8FA 4A73A 2Y67A 4AJEA 1VJ1A 1L7EA 1UXKA 4DPLA 3L4SO 1KVSA 1YH3A 3IJPA 4DYVA 1WW8A 1HDRA 3JD0A 2DBVO 2CUKA 4O6VA 5CEEA 2ET6A 1O5IA 4I1IA 3QJ5A 3WSWA 3BTVA 1T4DA 3PJDA 4NMHA 5BQFA 1ZXBA 5T64A 2HJRA 4D3DA 4NBTA 5KVVA 4KTVE 2YV1A 1NX6A 2BHLA 4FSHA 1MFPA 4OMUA 2J5KA 5KOIA 1O95A 4RDHA 1PQPA 2H6EA 4OXYA 3RVDA 4BO1A 1XELA 5KNLA 2E82A 3A28A 1Y5RA 3VH3A 3IMFA 3VDRA 1RYDA 3T7EA 1H0KA 3LF2A 3O8QA 3UN1A 2D3TA 2FMUA 4D0RA 4Y6RA 1NVGA 3WYEA 2BF7A 5BR7A 1MFZA 4WLFA 4HXYA 4F6CA 3EZLA 4CMCA 4QO8A 4CL8A 4CMAA 3GDGA 2VCYA 2GASA 2QYTA 3JYOA 3CIFA 1MC5A 3DOOA 4PLYA 3K96A 2WD7A 3GC6A 3DO5A 3WQQA 5LDHA 2HO5A 3I9NA 3F4LA 1I36A 4WE3A 4YT2A 4MIYA 1ZVMA 4E12A 4GSKA 4BO5A 2UVDA 3GFBA 1N92A 3WBBA 4AJ1A 3V5NA 1GY8A 3WYBA 3H2SA 4XIJA 1ZSVA 5B4VA 2DTXA 3QQPA 1U7TA 5JAZA 1S7CA 3D5TA 3GF4A 4CMKA 2C0CA 3U09A 4IMRA 4OIMA 2EKPA 2IEDA 2NV6A 4Q3NA 4QECA 1E0DA 2B4RO 1PR3A 3R6DA 4BNWA 1O0SA 1WAMA 1BDMA 2FR1A 1R4NB 4HKTA 1J49A 2PZMA 5JCJD 2C82A 2EW8A 3Q0EA 3WWZA 4PLTA 4W82A 1B15A 1BDBA 5L9AA 4R41A 1XEAA 4FOSA 1N9GB 1HE4A 3KM0A 3RD5A 3K2EA 3RC7A 1QORA 3VTZA 4AJNA 2JCXA 2E48A 2VOEA 2GGSA 1RWBA 2X9GA 5DBIA 5CG1A 3VH4A 2BGKA 5FEUA 5JAQA 2RAFA 3RUIA 4XQCA 1I2CA 5JE8A 1KEUA 2GN4A 3F47A 1JWAB 4GGPA 4IXWA 1NNUA 4BIIA 2VYVA 3EAGA 2CMDA 3G79A 2DPHA 4TKLA 1RJWA 2WJPA 1VC2A 1HDYA 1GUYA 5LC1A 1TVEA 2I66A 3NT2A 3OFSA 3U3XA 3OIFA 4W7IA 2D1YA 5JC1A 2Q3EA 5A3JA 3GRPA 1RPNA 5FWNA 1IZ9A 2NU7A 4GVLA 3WLEA 1V3TA 2BI8A 3MWDB 2BFOA 1IY8A 2NVUA 4P4GA 4BGUA 4M1QA 1I2ZA 2B0JA 1ULSA 2QZZA 2R2GA 2GN8A 1YS4A 4PLCA 3H5RA 2ZK7A 5JFOA 4M86A 1BXKA 1LDNA 2Q46A 4A2CA 1GQ2A 2NWQA 5JMWA 2B5WA 2GD1O 3UW3A 3JYLA 4O0LA 1BXZA 1ARZA 1WLYA 2DKNA 1YONA 4FJ1A 2I99A 2PH3A 1E3SA 2ZTMA 4IJUA 3L07A 1ONOA 1DAPA 1ADFA 3TZ6A 3BTOA 3PJFA 4DQUA 3ASVA 3I1JA 1KC3A 5L7WA 3JQ6A 1SCUA 4LSMA 1I10A 3JQBC 4R3WA 3EW7A 1P3DA 4YJHB 4ZQBA 3KEQA 1NTOA 3JQAB 3KXDA 4JJFA 2R00A 4QSMA 5F1PA 3T7CA 3WICA 1C1XA 2PA3A 4J91A 1E7SA 3QA9A 1MA0A 4D3SA 3P19A 4J49A 1DHRA 1EZ4A 2NU8A 5G0VA 1Q7GA 4Y9DA 3RWBA 3WTBA 1IOLA 3ZHZA 1KS9A 3ANLA 1ISHA 3GK3A 1U8XX 2NTVA 4Y6PA 1SNYA 4PZDA 4JGBA 3QWHA 1LRLA 3C85A 4OQZA 5BNFA 2Z1NA 1NFRA 3OQBA 4KP7A 4IIVA 2VZ8A 1GPDG 3TSCA 1I3LA 3HFGA 3HWRA 3HSKA 2FSVA 1T24A 2C59A 5A4DA 4IDCA 4NFYA 5JDIA 4UUNA 3TJRA 5JCJA 3GN2A 1U3UA 3DZKA 3WR5A 4EZBA 1QYXA 4I5GA 2J3HA 2YFQA 5K6AC 4CQLB 4BB5A 3RBZA 2DTEA 5AXCA 4FC6A 3FNFA 4NJOA 2NVWA 4ESOA 1YVEI 4YJFB 4BKOA 4JLWA 1LU9A 2C54A 4OHUA 3WMXA 4CMEA 3S55A 4WLNA 1WDKA 1LQTA 4J4HA 4MOWA 2WM3A 5LDGA 3I9LA 3WGOA 1CWUA 3GR6A 5TSDA 3A9WA 1G0OA 4RO0A 4B4WA 3AY7A 2B37A 4U8GA 4TRRA 1WNTA 5KJ1A 3DL2A 2P5UA 3DHEA 1TI7A 4F45A 3GEGA 2QRJA 3ICCA 5H81A 3BMNB 3DMYA 3OEYA 4J1TA 4NBRA 1EVZA 4LMPA 4J0FA 3NKLA 3X2EA 4RZHA 4FFLA 1AXEA 3GEMA 1ISJA 4OYRA 4ZD6A 2UUOA 3ZV4A 4E33A 1GD1O 2IODA 3VC7A 1O9BA 4BO7A 4K26A 4KQXA 1EVIA 3UHAA 4KUGA 9LDBA 1E5LA 3GAZA 2IYPA 5CPFA 3GZ4A 4RQTA 3EVTA 5L4LA 3NRCA 4IS2A 1F0YA 2AG5A 4BNJA 2VT2A 5K0ZA 4BNGA 3DZGA 1YGYA 5KJFA 1HZZA 4RPGA 1QR6A 4RORA 3I5MA 3ZGYA 1NYTA 4M89A 1JU9A 3ETGA 1PJ3A 3LLSA 5EN4A 4QT0A 1XQ6A 4G65A 2EKQA 4D43A 1YB4A 3IP3A 1TEHA 5DBFA 2GUGA 4CM4A 4XB2A 1YB5A 5EERA 2X4GA 3RUCA 3K92A 2I67A 4WEQA 3SLKA 3L4BA 1EQUA 3LT1A 1F17A 4E2YA 5L7TA 4TWRA 4YAJA 5CDGA 4DC0A 1ADGA 4OXKA 2F1KA 4IDDA 4GL4A 1DLJA 5C37A 1K6IA 1ORRA 5A3VA 3IAHA 1DOHA 3D3EA 5ENDA 4EW6A 4IQ0A 5DCYA 1LLQA 2AEJA 4ZQEA 1PL8A 1ZNQO 3Q2KA 4NBUA 1U7HA 1DIRA 1PZFA 4UEJA 3M2TA 1DIGA 4MIEA 4CR7A 3IOYA 1P1JA 4A5OA 2GZ2A 3HDQA 4YTEA 3FCOA 3GVXA 4WPGA 4K28A 5DT9A 1X7DA 4J16A 4TKMA 2BFMA 2D59A 1HKUA 1DIAA 1E1LA 1IHXA 2CZCA 5DNAA 1PJBA 1U3TA 1FJHA 1I3NA 2O3SA 1JKJA 2AE2A 3P5SA 3B6ZA 4D7AA 2V6GA 3WSVA 3CH6A 1CERA 9LDTA 1I30A 4NU5A 3DAFA 5HA5A 3KRTA 4MVJE 3GVCA 3ZWBA 3I6IA 2JFHA 5TF4A 3QHAA 2O7SA 3JQFA 4FR5A 4YAGA 2IXBA 3WWYA 1BWSA 1NAIA 3GN1A 2QW8A 5ITWA 4W9NA 2EJWA 5G0TA 1GPJA 4Q9NA 4EI2A 4FQ8A 2HK7A 3OBBA 4HV4A 2B5VA 1QLHA 3AOGA 3F6YA 3NAQA 4Q3CA 4YRAA 2PZKA 1K6JA 3E03A 3JQDA 3G0OA 4WNCA 2RH4A 1RM4A 1T26A 1VRWA 2QIOA 3TPCA 4XYLA 1DC3A 2W8ZA 3OA2A 2RIRA 2FOIA 4RF5A 2FZWA 2P4QA 1BRMA 2HSDA 2BGLA 3AUAA 4R4JA 5BSFA 5G2OA 4R54A 3SC6A 1LNQA 5KVQA 3BMNA 3DAPA 5U9CA 2ZATA 5THKA 2PWZA 5KTKA 2GPTA 2IEBA 4MKRA 4YB8A 2DQ4A 2EXXA 4KZPA 4XQGA 4PG4A 5F5LA 3JQGA 4YYZA 4Q3AA 2QG4A 2YDXA 3FHLA 4E5YA 3I83A 3UOGA 3NJ4A 4G5HA 2C2XA 3A14A 3V1YA 4LN1A 2EP7A 2ZJ1A 3G1UA 1C3VA 3TL2A 2X86A 5DCUA 3ABIA 4WOJA 3FF4A 1D7OA 3AUSA 4BNYA 2W2LD 5JNLA 1Q0HA 3PXXA 1DRWA 1LRKA 8ADHA 4FDAA 3AUTA 4R69A 3AOEA 4CODB 4XYMA 5JY6A 1LSJA 4BS9A 1JWBB 2X1HA 1NR1A 5T5QA 1UR5A 4I5DA 1LC3A 4A26A 4QO7A 3ZV6A 4MP3A 2AMFA 2ZKLA 1GAEO 2J3IA 1V9LA 3QV1A 2Y0DA 1IE3A 3VZSA 2HQ1A 3I23A 3NYWA 4FB5A 1LDMA 4Y98A 3OETA 3MTGA 1WZIA 1HDGO 1T2DA 1Z7BA 3C1TA 2QYSA 1HLPA 3C3XA 3NEPX 3D5QA 4AJLA 4AJ4A 1YQXA 1M6WA 2ZIZA 3PRJA 2IDZA 5I7VA 1YRLA 1LSOA 1JAYA 4ZQFA 1E3IA 3PDUA 3K31A 4Z0HO 3TRIA 4E2XA 3MJSA 4J7XA 1ID1A 2Q1WA 4GX0A 1PTJA 2X5KO 3ORFA 4UUOA 3JQ7B 4XKJA 4CM1A 1IPFA 1U9JA 3GPDG 5DZSA 3BMOB 4MVJM 4J2OA 5JYEA 4RJTA 1T25A 1PZGA 4BV8A 4KWHA 1WZEA 1C0KA 2YDYA 3LSYA 5IDYA 4D3FA 4MKZA 2G1UA 3GZNA 1U28A 2B36A 1EVJA 4PG7A 1WVGA 5TLSA 5CAEA 2HMSA 2UAGA 1VSUA 4B3JA 1UZLA 2WYVA 3WJAA 1AHIA 1AGNA 3I4CA 2X9VA 3FNHA 3UVEA 3IDSA 1ISGA 1CEQA 2H9IA 2QQ5A 1XWFA 2AHRA 2D4AA 4NK4A 4J7UA 3RIHA 3MZ0A 2BH9A 2JKVA 1Y7TA 4A03A 2PFGA 3RJ5A 4O63O 2AE1A 4UEKA 3DBLB 4AJHA 1EK5A 4DTIA 3K30A 1E6UA 2Y93A 3FNEA 1G0NA 4CM9D 5KVCA 3KEOA 4WASA 4ZQGA 1FXSA 1RM5A 4NU6A 4GGOA 4FN4A 4XYEA 3TFQA 3MJVA 1R15A 2OZPA 3AI2A 2CVQA 2WE7A 5U1PA 4L73A 5L51A 3UCEA 3ULKA 5A02A 5FYDA 3AW9A 3U4HA 1P45A 2YW9A 2CVOA 3VHRA 2I6TA 2NSDA 3ZV3A 4IJVA 4NIMA 3GNQA 4R5MA 1F06A 2DM6A 3WXBA 1FDVA 5HBRA 1PJ2A 2VQ3A 3F5QA 4PVCA 2W2LA 1A71A 1Z82A 3JD1A 2HRZA 1NASA 4RPLA 2J3JA 1PX0A 3QWIA 1X0XA 1OZAA 4GH5A 4XQEA 2IYOA 4C7JA 4EUFA 1U1IA 1TT5A 2WD7B 1GYRA 4AJOA 5ICMA 3RI3A 2SCUA 1A27A 4W4TA 2V6FA 3JQ9C 5CP8A 3OICA 5CEFA 3ZWOA 3VPFA 1MGOA 3DTTA 4LCEA 3V2HA 3BTSA 4CL3A 4CLRB 3B1KA 1SOVA 4XA8A 3I9OA 2NUAA 1Y5MA 4IZHA 3H9EO 3NDJA 3KVOA 3DOJA 4QQRA 3PPIA 3ZWWA 1HYEA 1UXJA 4YXFA 3WFJA 2D8AA 1V8BA 4KQWA 1U5CA 3ZV5A 3ZU2A 4BNNA 2EW2A 5EINA 4CM3A 4GBJA 4U5QA 2WYWA 2P5YA 4BO9A 2VN8A 3FNGA 4D79A 4ZN6A 3U4DA 4DWVA 2Y1OA 4RPJA 1UDCA 1NR7A 5C3MA 3LT2A 1WMAA 1U8FO 1ZXLA 1B3BA 3VZPA 4KDFA 1T2EA 3PIIA 2A35A 4CJXA 1NQAO 1NFFA 4K9DA 2FPPA 3B20A 4FBGA 4IQGA 3JQ7A 4ZU3A 2Q2VA 3WIEA 1IYZA 1DC5A 4E5PA 5JY1A 5A5EA 1ZZEA 2H5LA 3I9MA 3BMOA 3U0BA 3FBTA 1YL5A 3N74A 1N7HA 1A4UA 4GSLA 4YRBA 3ZZNA 2I3AA 1I3MA 4WCDA 1QXSA 1OFGA 4DA9A 3WIDA 5CFZA 3G17A 4E4YA 1YL7A 3AU9A 1PJQA 4J7CA 3DXFA 4RL6A 1ENOA 1QYVA 4B3IA 2EKLA 4Z9YA 3E18A 4R5HA 4DLBA 1JKIA 1O94A 1MX3A 3E82A 4MPDA 5AYVA 2AQIA 1R12A 4DQVA 1V0JA 1C1DA 2NVUB 3FWNA 6LDHA 1TT7A 4KDEA 4HWKA 2PR2A 3D4OA 4RV9A 4UVEA 1DXYA 1FDUA 1BW9B 4IGFA 4WKGA 5I7EA 1DDOA 2BKAA 3DBLA 5TNXA 3BZUA 3KSDO 3BMCB 4B4UA 1HLDA 3UUWA 4RVHA 3HZZA 1WDLA 4E5KA 4Z0TA 5K9ZA 1ENPA 3GOHA 3GG9A 4YBZA 3VKVA 4F46A 3EGOA 2PKQP 3SXPA 3E8XA 1XLTA 3NTOA 4M54A 2VOJA 4FPXA 1ZUD1 1IL0A 1X1EA 1OMOA 2JFFA 3IUSA 3ONEA 3OIDA 2Q45A 4IXTA 3ROKA 5CDTA 3HNPA 4KUHA 3MJCA 4DC1A 3E9NA 4RGBA 1LDBA 1AXGA 2IE0A 5DP2A 1KYQA 1K89A 3SVTA 1O89A 3MOGA 1HT0A 4E6PA 2VZ0A 4XR9A 2X22A 3ANMA 5I8WA 1JKFA 4L4SA 4CR8A 3R3JA 4BNZA 5JDCA 1C1XB 2QRLA 4BGIA 4CQMD 4CV0A 1NQ5A 4JCOA 1RM0A 3PYLA 4IGEA 4URFA 2Y1EA 3C24A 3GNSA 3U4IA 2PK3A 4ZJUA 3KYBA 2F00A 1DC4A 4BHTA 1XU7A 3PFWO 3KYDB 3DMTC 2CF6A 2RCYA 4CLRA 2DBRA 1KBZA 1M75A 3EMKA 4L76A 5DULA 3VPSA 5A9SA 3KBOA 1BTOA 1VM6A 3UAGA 2PZJA 4P4NA 3ZWVA 2R6JA 4HFRA 3W4JA 1Q0LA 1DIBA 3AWDA 3H7AA 4D42A 2HMUA 5TX7A 4EITA 2GN6A 2Y1DA 4QFCA 1EQ2A 5COBA 4I9HA 4XYBA 4BO6A 5TC4A 3EK2A 1NFQA 1D1SA 1F12A 2E6UX 5JC8A 3RUHA 4YR9A 5KVSA 4TQGA 1AN9A 4E2ZA 4MVJA 1XG5A 1P31A 3HUDA 1GV1A 1KIFA 1FDWA 4NI5A 4G2NA 3Q1LA 3N58A 1HZJA 2NACA 1T2FA 4PLHA 4N5NA 3PP8A 2IXAA 3U62A 3WQSB 1PR9A 2J5RA 4J9UE 1TXGA 4NK5A 4C7KA 1JQBA 1TB4A 4HNHA 1U2DA 1JTVA 3E48A 4A0SA 3EHEA 4GMGA 4CM8B 4EUEA 4H3VA 4ALMA 4E2WA 1A4IA 2ZB3A 1A9YA 1X1TA 2GF2A 5JO0A 1HETA 3AY6A 3I52A 3JCZA 4J6FA 4XX0A 4ROSA 2DVMA 4I9UA 3PLNA 3D4PA 2BFPA 4WLEA 1W0CA 2VYND 3P2YA 4PLZA 1XGKA 2W90A 1IULA 1LUAA 3AM5A 4CM6A 3D7LA 4OO3A 1EDOA 4HADA 4QUKA 1H9AA 2EGHA 4ND3A 4UVGA 4YPOA 2HU2A 3RUEA 4K6CA 3RU9A 3PZBA 3C7CB 3DBVO 1O8CA 4LVUA 1BW9A 4MP8A 5HS6A 3HFSA 3BAZA 5IDXA 5JBIA 1VKOA 3BMCA 2OP0A 5I9MA 4OQYA 5B12A 5JDIC 4XCVA 8LDHA 2BLLA 3DTYA 1UP7A 1Z6ZA 2VHYA 1NPDA 2ZCVA 3RCBA 2B4QA 2I9PA 4YAEA 3GA0A 3D64A 4O59O 3SBOA 1UP6A 4NH4A 2HLPA 1GZ4A 1WWKA 5L45A 4IZIA 2HRBA 2Q2QA 1J5PA 2EV9A 1R0SA 2G5CA 3KV3O 1RYEA 4U0JA 4CM4B 4CMEC 3WBFA 1QLJA 1QRRA 3L77A 3NGXA 1C0IA 1P1KA 2A9FA 4XR4A 5JSFA 2GLXA 4LRTB 3H9UA 4CQMA 2GCGA 4GI2A 1I0ZA 1JAXA 2ZTLA 3RROA 5DOVA 3WJ7A 1FF9A 1UZNA 5C5IA 3FPLA 1PQUA 5A03A 1I32A 3ICPA 4R51A 4Z9FA 2VTEA 1P74A 1GCUA 4J43A 4BMVA 3KO8A 3MJ4A 4EDFA 4DGSA 1D4FA 4WCFA 2AEFA 1MG5A 2Y99A 4XGNA 3KYDA 2Q4BA 4H16A 4IDBA 2Z95A 3EDMA 1VL6A 3CUKA 3H9GA 1KEVA 1BMDA 3GGPA 4GQAA 1QYWA 3N7UA 2ZQZA 1ZMOA 2JD1A 4ALIA 3JQAD 3JYQA 3OJEA 3ZWMA 2XAAA 3DQPA 1MXHA 1ML3A 2Q2WA 1ISFA 3D4NA 3DZHA 4OOFA 3SJ7A 4B8ZA 2AQKA 3DC2A 5IG2A 4K1LA 3QY9A 1PL6A 2CD9A 3WNVA 3WDSA 1JW9B 4HUJA 4J1NA 5TQVA 4BQRA 3H3JA 4A10A 4PLWA 1O6ZA 4EJ6A 1YQDA 3LC1O 4DVJA 4ZHSA 1U2GA 3TZQA 2Z1MA 1OOEA 5BT9A 1A7AA 1EDZA 1WPQA 1E92A 2E49A 3CMCO 3FTNA 3PQDA 5I9NA 2A94A 1UDAA 3WGIA 3AY3A 1H6CA 4QFDA 3WGQA 1XHLA 1KVQA 2RHRA 1B2LA 2IRWA 3L4BC 4J1SA 1E3JA 2PTGA 4DUPA 1GUFA 4CM8A 4MVJG 4IDAA 3H3FA 3GMDA 1QYCA 3ITKA 1XKQA 4B8WA 1BVRA 3MTJA 2C7VA 4IJKA 3PIDA 2VHZA 4E5MA 5CDSA 1EFKA 3TFOA 2AQHA 2AG8A 3E1KA 2JD0A 1EUCA 2Y1CA 3BXXA 4UUPA 3IJRA 1ADCA 4O1MA 3V1UA 4GPD1 2B4TO 3VOSA 3B70A 3JQGB 4FJ0A 2CY0A 2BRUA 1LDEA 1HE3A 3WGTA 4IDFA 1DIHA 1PWZA 4RVUA 4PCVA 3GLQA 3TNLA 2YZ7A 4QXMA 4KUEA 3DFUA 2VUTA 4ZRMA 5IDWA 4CUZA 4CLHA 5CPBA 4JNKA 5H82A 1N2SA 5AQ1A 3K6JA 5JS6A 4YJGB 3KSZO 5JXWA 4MDHA 1K3TA 2G82A 4DXHA 3JQCA 2C2YA 3V2GA 1YDEA 3AM4A 2JL1A 1AUPA 2DPGA 1X7HA 3L6OO 4QX6A 4W99A 4ALNA 5TT0A 2O50A 4ILKA 4M87A 1A9ZA 2DT5A 3A1NA 3S2GA 1I5RA 2VRCD 4L0QA 3QSGA 3ZWXA 3RJ9A 1LC0A 2FY8A 4JQCA 1EMDA 1MP0A 3LF1A 3AFNA 4W9NC 1MC4A 3PYMA 2PD3A 4FD3A 3EUWA 3NT5A 2YHUA 5T8KA 4B3HA 4D41A 4XRGA 2GERA 4FFOA 1RKXA 2G76A 4NFHA 3FD8A 1JLLA 3GUYA 1LLCA 1N1EA 4H15A 5FI5A 1ISMA 3INRA 2VNAA 3AU8A 4IDEA 4P38A 5BSGA 3SJUA 1Y8QA 4E21A 4JJIA 5KKAA 1FMCA 1L7DA 4MVJH 4R68A 4JX8A 2RH8A 3GZNB 4EGFA 5JO9A 2H1SA 2FHSA 1M66A 2WE8A 2Y1GA 3PHJA 3KETA 5EQFA 2CNBA 3GEDA 2HKIA 3E6AA 3I6QA 3I9JA 4XEHA 4IJWA 4TRNA 1UH5A 3PI7A 3K5PA 4MP6A 5CDUA 3MOIA 6ADHA 1X13A 4U0KA 4GLOA 3C7AA 1YDWA 3D1LA 1PU2A 2NLOA 3H9QA 4UULA 3AOEC 2ZQYA 4OM8A 2ZYDA 4B4VA 3HE3A 5B1YA 1ONNA 1NVMB 1Y8RA 2GZ3A 3GVIA 4YVFA 5JAMA 4DIOA 2PKRA 1YO6A 2DTDA 3COSA 3DBRA 1P1RA 3QVXA 4NR0A 3W4KA 4EBFA 3ASUA 4L8VA 3ZHBA 1KEWA 4R1TA 1HDXA 3U4CA 4A27A 1HTBA 5KJCA 3I4FA 5TIIA 2NM0A 2ZB4A 1HSZA 1DAOA 1K5HA 1UAYA 1E6WA 1I2BA 5AXDA 4R9SA 3ZWPA 3OQ1A 1NPTO 2I5PO 1DLIA 3KSUA 3WGHA 4BVAA 2X0JA 2VHVA 5T67A 5IFLA 1B26A 1KETA 3LDHA 1XYGA 5ICSA 2WWRA 4J4TA 3PHIA 3E9MA 1A5ZA 2HK9A 2XF8A 4DRYA 1ZW1A 4D0SA 4JROA 1N8KA 1BXGB 3W8DA 3IS3A 1R37A 4FFMA 4CV1A 4TRMA 1RM3A 1I24A 1P33A 2ZCUA 1Z45A 3ZWYA 4MVJI 1DHTA 1EBFA 3O26A 4YWJA 4E31A 5CEJA 1T1SA 5DDIP 1KVUA 5L4SA 1B0AA 3PZRA 3UXYA 1V35A 1B8PA 1T4BA 5F21A 3DONA 1TT5B 1VPDA 5KKCA 3OHSX 5IDQA 4WUVA 4YJGA 4XQ9A 1GFSA 3OECA 4Y67A 1E3WB 3KYCB 2PD6A 3BA1A 5IXSA 5BSEA 3O38A 4FCCA 3KB6A 2Q1SA 1R66A 4P4LA 2VRCA 5ER9A 3WTCA 3PTZA 3ZI0A 4XZ3A 2NQTA 5IF3A 3C1AA 2YHIB 1YKFA 4BL5A 3SLGA 2RHCA 4FJ2A 3W4IA 4BNKA 5EMHA 3TDKA 2JD2A 3O4RA 4YAKA 4Y6SA 2FR8A 3OM9A 3WB9A 1PS8A 3CTMA 1X0VA 2GZ1A 4TMFA 2X0RA 5COQA 5COAA 5G4LA 2C7GA 2LDBA 2X5JO 1KOLA 5HRUA 3WFIA 1PJLA 2EHDA 2O4UX 3LC7O 3V1TC 5A1TA 1ZSNA 3AFMA 3INGA 4HP8A 3OEWA 3NJ8A 1SEVA 1K0UA 1DFGA 4B7UA 1EUDA 3WOHA 5DF1A 4ZICA 2D5CA 1NP3A 1WP4A 4IIUA 3WMWA 1IUKA 1Y81A 2VNSA 2G0TA 5JYDA 3S2IA 1GV0A 2FP4A 5MGBA 4Q39A 4QEDA 1ZKMA 5J23A 4RCVA 1M67A 3FPCA 4YQYA 2EG9A 5FFFA 4WLVA 3U9LA 2HMTA 4IM7A 1SB9A 3F4BA 5BNIA 1B3RA 1S6YA 4BNFA 1GL3A 2BD0A 2JAPA 3AI3A 3JV7A 2VZ9A 4NDNE 2PY6A 4PFJA 1KC1A 2EIHA 1KVRA 3BHJA 2TMGA 1C1DB 1HYGA 2JFGA 4NFSA 2OO5A 3OH8A 4INAA 1LA2A 1GU7A 2X0IA 3RBVA 1VLLA 4II3A 3EYWA 3F3SA 3C8MA 5DP1A 2CSUA 2PKQO 1R16A 1XDWA 4B4OA 1E1MA 1LEHA 1T1RA 1E7WA 1DB3A 3AUUA 4XD2A 2DC1A 3ANNA 3HHPA 4NJMA 4EYEA 2LDXA 3GAFA 2OP1A 3K8ZA 4OGWA 5A9TA 3VDQA 4GX2A 1Z73A 1J6UA 3Q11A 1Q7CA 3F1LA 1BXGA 3NT4A 4H7PA 2JCVA 2NTNA 4ND1A 4BB6A 4BKRA 5F5NA 1PJ4A 1LDGA 2GO1A 4I5FA 4MVJF 4YCAA 3L0DA 4WK6A 1R0LA 4MO2A 3G3EA 1B7GO 2X7HA 1BGVA 3GHHA 2PLAA 4DBVO 1ZEMA 4HNGA 4CMBA 1Y9AA 4ALJA 3ROMA 3JYNA 3Q2IA 1GDHA 1NPYA 3PJEA 5B37A 1TLTA 2PD4A 4GWGA 4I9NA 1SC6A 1E3WA 1P1FA 4W7HA 2CF5A 3KYCA 4M49A 2O4CA 5CG2A 1JA9A 3KLMX 2IZ1A 4PLVA 2O48X 4OKIA 4F6LA 5A9SB 3C7DB 4HBGA 5IZCA 4JP3A 2I76A 2C5EA 4HFNA 2FZEA 5ER6A 2AQ8A 2YHIA 2OL4A 2AA3A 4RPHA 3W6ZA 1SZJG 3GT0A 4CLOA 3WG9A 1PIWA 2UV8A 3EVNA 4BKUA 3HJAA 1CETA 3CEAA 3PGXA 5G0WA 5LCXA 4BNMA 2CDBA 2Y05A 3GDOA 4DREA 1MLDA 2J8ZA 3S2EA 3EC7A 1W6UA 3TL3A 1YB1A 2QZ9A 4PVDA 1YJ8A 4EJMA 1EE9A 3BHMA 3F9IA 2C29D 3D3WA 3VPGA 1JVBA 3VVCA 1PQWA 3T4EA 3MCVA 3RUDA 3WGYA 1B8VA 3H6KA 1Z7EA 2C20A 3PFFA 4LVCA 3TOZA 3PQFA 3DAGA 2JHGA 2BMAA 4J4BA 1NVTA 2YUTA 1WMBA 4DQXA 4ZQHA 2WEKA 2QRKA 4BV9A 2WYUA 1GTMA 3GGOA 3WX0A 4Z6KA 3I3OA 3PVZA 3DZFA 4AJKA 1QKIA 5EL0A 1YBAA 3G1TA 3QVTA 1YBVA 3RKRA 4UVHA 4OSPA 2X9NA 4XRRA 3QVSA 4FFRA 1OI7A 4RF2A 1M2WA 1UJMA 2W2KB 1H6BA 1DJNA 3ZNQA 3HB5X 3INTA 4L4RA 5B4UA 2W98A 1ZK1A 2VYVD 3NX4A 1R4MA 4TZKA 3UCFA 4CR6A 4BGVA 4E0BA 3M1LA 4Z3DA 5C7LO 5EJ2A 4PRLA 5TS3A 3JQ9A 3DFZA 4CM9A 1MXFA 3KLPX 2TMDA 4N5MA 4OAQA 1ZCJA 2GR9A 4GWKA 1GR0A 3PLRA 1CRWG 1Y9EA 2OGUA 1YJQA 3IL2A 1PGOA 1T2CA 2OORA 5GMOA 2EWMA 2ZYGA 3W6UA 4BO3A 4BO8A 3EZYA 4DMMA 2YFHA 4GVXA 3ONDA 2NQ8A 3LT0A 4ZGWA 3B1JA 2FRDA 2UDPA 3ONFA 2HMWA 2WD8A 1PS0A 4GX5A 1MV8A 4JBGA 4TRJA 3HN7A 5C7OO 3GG2A 1VE9A 2X23A 1UXIA 4Q3EA 4FFNA 4YDRA 3JQ8B 4GKBA 2BI7A 5F1KA 1P0CA 4CQMB 4EUHA 1EFLA 1ZFNA 5C7IO 4DLAA 1E7QA 3O03A 4II2A 4XGKA 1Z75A 2UUPA 2ZTVA 1H6AA 2Q4EA 1NHGA 3CZRA 1Q0QA 1VJTA 2E4AA 2V6BA 3E5MA 3R3SA 1YQGA 2YQ4A 3RKUA 4LMRA 3ZNNA 2V7PA 3MJEA 3ZW9A 2JHFA 4J90A 4BKQA 4WCFB 4DBZA 1CYDA 1UP4A 3X2FA 5TT1A 1DO8A 1EBUA 5L7YA 5G0SA 3QVOA 4CMIA 2YJZA 2YYYA 1EE2A 2Q1TA 1HYHA 2GNAA 2DU8A 3MJTA 3GPIA 1ONPA 2PZLA 1DFIA 4CMJA 4WLOA 3STHA 4AG3A 5A04A 2NADA 5AVOA 2XXBA 2P68A 3F46A 3CINA 1CIVA 3HN2A 5FI3A 2XXJA 2DUUA 3QRWA 4A7PA 4DPMA 1H2BA 2CDAA 3ETDA 1SB8A 3OJFA 3ON5A 4F3YA 3D0OA 4IMPA 3GDFA 4YT8A 3WS7A 5T57A 1GADO 4ZVVA 1FK8A 1PSDA 3CSDA 2PGLA 5EESA 3W1VA 4D44A 1KERA 1Q7BA 3JSAA 4YA6A 3JD4A 1LJ8A 2HUNA 3GUCA 4WGGA 1G1AA 4L75A 3UH1A 4E13A 3NDRA 1V3VA 3GMSA 4Q3DA 2Y68A 3BMQA 2X5OA 4DLLA 5ITVA 2D0IA 4Z3KA 4M8SA 4PLPA 4R9RA 3OA0A 3QLJA 1A7KA 2EEZA 3L6EA 4E32A 2VRBA 1PZEA 4TVOA 2R00C 2P4HX 4JIGA 1H2HA 4FGSA 5GY7A 2BGMA 3H2ZA 2P91A 3C1OA 5GZ6A 1FDTA 5G4KA 4BMNA 1PL7A 3DB2A 4YACA 2XPCA 2YQ5A 3Q3CA 4WCFC 4CLEA 3DEYX 1PZHA 2W2KA 2X6TA 4IY1A 1E3LA 3FR8A 3ENNA 3H4VA 4Q3BA 1ZIDA 2GYYA 4N18A 1HEUA 1K2WA 4S3MA 2P9GA 4PIVA 1XR3A 3F1KA 4PG6A 2EJVA 1KY5A 1DJQA 3L9WA 2VHXA 3GH3A 5A5FA 4GAEA 4TVBA 3ZDFA 3DMTA 3TZHA 5L3ZA 1QP8A 4E3ZA 1E7MA 1HRDA 3IC5A 3RFXA 1GUZA 3BTUA 4MINA 3I9KA 2JCYA 2JJYA 1EVYA 5F3RA 4DYDA 1UAGA 1Q1NA 4I5EA 3E9QA 1N5DA 4IS3A 3PHGA 4D45A 1HWYA 1WDMA 1E1KA 3DBHB 1VSVA 4BNUA 1YOVB 1PGPA 4D46A 4CV3A 2Y0EA 1SO8A 1B16A 5L53A 4B7CA 3RSHA 1R0KA 5H83A 4J0EA 3JQ8A 2D5AA 5IAAA 3KZVA 4PLGA 4U6QA 3VAZA 4BKPA 3RASA 4NNJA 2ILTA 2RBEA 1C14A 4ND4A 1XCBA 1ZSYA 1ZJZA 4GX1A 3VH2A 1UDBA 3ZHYA 3WQRA 3RAJA 4E30A 1KY4A 4TSKA 3DZJA 4G81A 1DBVO 3M2PA 4B7XA 2VTDA 1DPGA 1VL0A 3FSRA 1LSSA 3W8FA 2VWHA 3W8EA 5DBGA 1GQQA 1Y8QB 3RC1A 4XB1A 4DMLA 2X8LA 4EEZA 2DAPA 5IXYA 2EP5A 5BNTA 3PJGA 2Q50A 2EF1A 2FWMX 3ZU5A 4C4OA 3DDNA 5T6BA 2V6MA 4M55A 2ZB8A 4CM7A 1HE2A 1J0XO 1GZ6A 4OL9A 3HDJA 4JXKA 2YY7A 4XIYA 2CVZA 1UXHA 1NM5A 4PG8A 5I8ZA 4UVIA 3ZU4A 4N7RA 3KUXA 2AXQA 3IUPA 4RVSA 5EPOA 4DIFA 2P2SA 3OJ0A 1MG0A 1YE3A 5B4TA 5TGDA 4BNIA 4J3FA 1Y8RB 5KWEA 2DFVA 4NHEA
chains in the Genus database with same CATH superfamily
4DWOA 1JDZA 1FUYB 1Z6PA 1TUBB 4RPKA 1BWRA 4G86A 4H7EA 1IY2A 4QDKA 1U3WA 3VSEA 1LLDA 3EOZA 2IU6A 3FN4A 4R3NA 4YPFA 3Q9UA 2QJOA 5HP4A 2C92A 2ZRJA 2G17A 4JP2A 3TN7A 1RW4A 4DABA 1R4AA 4Q3OA 2F3UA 1XIVA 2J48A 4RVGA 2ONYA 1DEXA 2D1QA 2G9VA 4JBXA 4D9CA 4BATA 4C0BA 1N9GA 4LHEA 3S1LA 2EQBA 3UGKA 3LU1A 1R6UA 4G56A 4MPTA 1SUFA 3NVMB 4OSOA 3TWOA 2VYNA 1XPRA 1LSUA 4I08A 3FCAA 4KO3S 3QBJA 3H5AA 1P0FA 3AV3A 3JD3A 3H83A 4JFRA 3O1JC 4EG8A 2ZYAA 3A9TA 1C8BA 2ASEA 4RIGA 2JGDB 2WHPA 4DYHA 3WYCA 2P9ZA 4S1WA 4FZJA 2XWBF 3G9UA 3SC4A 2PL3A 1V7ZA 4JLDA 3OMLA 2DWCA 3WNDA 4XDGA 1HQDA 1X7XB 2PZBA 3UKOA 3ZGZA 4A0HA 2KE5A 5IK2D 4EW3A 1IN6A 1Y8CA 4GM1A 4JLBA 3JW8A 3UJNA 3AKYA 4GO1A 3NG1A 1OYOA 1SC9A 2A7XA 1FU4A 1NAHA 4P4TA 4BUJA 2DKOA 1XZQA 3OZBA 1UUFA 5THXA 4RZUA 4KACA 3UF0A 9ABPA 1X9GA 1IZ0A 5FJIA 3UAWA 1NX9A 1FFSA 3GELA 2W2OA 4S1NA 1YHYA 1AKQA 5F5XA 1GLNA 3MWDA 3OAAD 2O2EA 5H7XA 2V1UA 1N2CA 3IB6A 5GJWC 2Y4OA 4QG7A 2BEWA 5JAHA 2VJMB 4Y8VA 1XA0A 4FI3C 3KB8A 4MKXA 4QOFA 5FF9A 1H2EA 4HWTA 4OPMA 2HA6A 5EZYB 1INLA 4ME6A 1GQYA 2Q5CA 4HPJB 1OTHA 1EFTA 1ZK3A 3CUEF 1G98A 1Q5PA 4UVDA 3SEAA 3VI4B 3RWOA 2UZ0A 3FVRA 4LNUB 1H69A 4NKRA 4NEHB 4NRDA 4EY8A 3ZD6A 3KHUA 2O2YA 3FETA 2PIDA 4U9IS 5E3JA 5THQA 3WL3A 5KX5B 1EB8A 1GGEA 5DHFA 1GFIA 2E21A 2CJPA 4CLXA 4PYKA 1NLFA 3MWEB 4NCJA 3O84A 4GYKA 1T6ZA 3RTAA 4D57A 4BMSA 4LRWA 4OTZA 4Y9RA 1ZD4A 3FVQA 1QFXA 3AI1A 3DLAA 3OESA 3SYKA 4WBNB 1RLOA 2F43A 3KT8A 1QGYA 1I3KA 1MB9A 1W48A 1CDOA 3P9RA 1FFWA 1ZRMA 4RTRA 1H22A 1JBEA 3NONA 1PR6A 1BH6A 3O74A 2WFAA 1U2RA 4XDZA 5ESRA 1P81A 1UBLS 2GXSA 3RS5A 3AVYA 1EUDB 5HXAA 1ZGCA 1F8UA 1QVRA 3BXHA 3M1AA 3ZDXB 4G0PA 1AE1A 3EARA 4WD3A 3LWNA 1MIHA 4BNXA 1YUMA 1QBKC 1Z8FA 2FP4B 4H7HA 1SJ9A 5DW3A 3A06A 2ZRGA 3HL4A 2GD2A 2A2ZA 4LK3A 3WB2A 3UJ8A 2VSXA 2Y0CA 1DDIA 4KFTA 3TW6A 3C1UA 5AIAA 5GONB 3EMVA 1K5DA 2C2WA 3FA2A 2FRXA 3BIOA 4JLMA 4HOYA 2CMKA 1RWXA 5CDHA 4AQYB 1NDUA 3EVCA 3R0QA 2W8BB 3LFUA 1MAHA 5LSAA 1MT3A 2C94A 2JHAA 1U3VA 2VUUA 3NIGB 4H4DA 2VQEB 4KQ1A 1Q92A 3MLEA 3I5YA 1WBBA 3I9V1 1ZK2A 2GZAA 4RV5A 3ROPA 1DJPA 2B35A 1JJAA 1Y34E 2XUZA 4YXWA 3RU7A 3ZWCA 4PGFA 2ECFA 3D8SA 4FOOA 1KI6A 1UJ4A 4FOTA 3WB0A 1S8OA 4P7GA 2IZZA 2ZGVA 3PHHA 4JUBA 4R7ZA 3VPXA 4DWJA 4ER3A 4ZO7A 2Y9MB 1U0RA 3DHNA 1K0FA 1FUKA 2YIMA 2ZWPA 2WM2A 1IHYA 1IY9A 1GZVA 1UANA 2IYFA 1ESDA 2Y4NA 3FPKA 1E77A 1QIIA 3GFGA 3NDIA 3WLIA 4CQLA 2LUOA 1QZUA 1P4GA 4OL0A 1UJ5A 1C80A 1ZA2A 4K1XA 2OMKA 1OBFO 3VO8A 4N5IX 2OXIA 1SUSA 3LQFA 1G8KA 5SZHB 3HU1A 1P0PA 1EG7A 2PS3A 5HS4A 3BQNB 4YAIA 1U7WA 1OLSA 2WZCA 4HF7A 2EL7A 1QO9A 4P58A 4PAQA 5KIAA 5AFSA 1USGA 1Z0UA 1EWQA 3T54A 4RKRA 2CVPA 3W9UA 4KX3A 4LC1A 3SJZA 4O08A 1AVTA 1NBOA 3O7WA 4WT7A 1EX1A 2C2BA 2FJUA 3QXSA 5HDQA 3MLAA 3RUAA 1PTJC 1G17A 2YZMA 3BMXA 3T38A 1ZLYA 2JFPA 1DC6A 4AF6A 1P72A 1JG4A 1FPMA 2FEMA 4FHFA 4HRXA 3KLBA 2WTNA 1I13A 3H18A 3PHLA 4QGFA 1FYFA 5EIFA 2NO6A 1J2YA 5CXXA 2Q8QA 4OH1A 2ILVA 3IVCA 3ICEA 1UOPA 2H4FA 1UXGA 2AYYA 3E9DA 4TTSA 5J4VA 4ND2A 1LTHR 1W85B 2JI8A 4L2IA 2W58A 3HRKA 4NZPA 3UYLA 3VTFA 2CDCA 2HMVA 4QT4A 4Z0PA 1VBNA 3AJRA 3UTCA 5TMBA 4BZPA 4G5RA 1GGKA 1UZAA 3AIMA 3DAHA 3LZ6A 2OZEA 4KI7A 5HE8A 2NSYA 4D9FA 5FAKA 4N7MA 3NTXA 3V8EA 1ISIA 1O1YA 2DECA 3IRVA 4N3AA 3R8XA 1SCBA 1OAAA 1S8AA 1X80B 3PUHA 5AXAA 1FU8A 4JT2A 5HBGA 4QGAA 3P2EA 2XOEA 5EZYA 1H5UA 1SOWA 2FX3A 4BFXA 1XZIA 4CLDA 3H2KA 4N54A 4W6ZA 4LWOA 4UUMA 1SIWA 2Y2UA 4X20A 1T2NA 4UBNA 1EGAA 1U8YA 4KYIB 1T4GA 4C78A 2IYWA 3L7OA 4EBBA 2PJRA 3UHFA 2QG9A 4PX5A 3RGGA 2GSDA 2CL6X 2D0DA 2NNLD 3O9MA 2YNMA 3UT0A 3WLNA 1FS5A 3B1FA 4MVWA 1U2PA 1N1GA 2C07A 1QH9A 4LBVA 1KH3A 4WBNA 5I9LA 3KE9A 2ZSAA 5BV7A 1EK1A 4ONEA 2GCNA 1H6DA 3FPSA 3CZ5A 4IWXA 4ND5A 4F8YA 1JEDA 3M4NA 3OOSA 3ORQA 4A26A 4B44A 5C4GB 5A4JA 4LQDA 3OTQA 4MS1B 1RJ9B 2I6GA 3JY6A 4G5GA 2GRAA 1CR2A 1UWKA 4MGYR 4ITUA 5C8YB 3ID6C 4ARAA 3EPKA 2O0LA 4LW8A 4GNKA 3ZDBA 1Y4ZA 4XTRA 1HYBA 2WPDA 3QTLA 1Z35A 2ZJ0A 5EQJB 1QZXA 3LC2O 2XRZA 5BN3A 4MJ3A 2HRQA 2WHEA 3SHOA 4HDSA 5JNTA 1SXPA 1L3BA 2BGGA 1H1DA 2OOSA 1XRLA 4HFMA 1R6BX 5AR1A 2KX7A 4DWWA 4TM7A 1NVVQ 3NHFA 1MJHA 4N1AA 5HZMA 4KOAA 5LYYA 3C3YA 1ICEA 2DUMA 1JFTA 3MHTA 4O4LB 4TTJA 3CMMA 4WSOA 4EJSB 1GCOA 4X66B 4YI3A 3RFVA 1JDJA 3OPYI 3JYPA 2W6NA 4EAAA 4K9NA 1WULS 2PANA 2QT0A 4JJGA 5BWLA 3KSBC 4PZ9A 2A92A 1DEHA 1PGJA 4AVYA 4UAVA 1LPNA 4X3PA 1MQ9A 3CLRC 3PUJA 1S9DA 1V8DA 1XMJA 2VBFA 3EH1A 1BXRA 1K75A 4EA9A 4EGJA 3GXOA 2Y6UA 4ZI2A 3DLBA 4GBMA 3MHPA 1R4MB 1LV8A 4CTNA 3CNQS 1WEHA 3KDSE 1I33A 3L0OA 1V8FA 3EXAA 4AQDA 4EX7A 1CY1A 3L7KA 1FUIA 4LF8B 5NULA 3O82A 3R9KA 2CLKB 4JOQA 1TFUA 2CXSA 3DDZX 4A8JC 3H4IA 4JBWA 4DL9A 1SUWA 2BFCB 4DR3B 4WZ6A 1B6TA 5AUOB 1QAMA 1VIAA 3EOBI 2QVXX 4R1NA 4DJDC 5I7HA 1JSLA 2JF0A 4CEJA 1XQ1A 4NYIR 1VKHA 1AUVA 3VX4A 3BAFA 5G3YA 5T7BA 3PUIA 1RZRD 3VKHA 2OBYA 1C3OA 1RQGA 1DRVA 1NJ5A 3O1LA 3T7AA 3NMUF 4ESEA 4C6RA 3QUAA 3JAWA 2REOA 1AF7A 4TT8A 1RWWA 4B1FA 5ES4B 2XJ9A 2OMEA 1BQ4A 1M0EA 3KKZA 5AOVA 4EG3A 2ZWOA 4G9EA 4IPTA 1QK3A 3VR2D 2CVHA 4KTTE 1IRIA 2R7KA 1NBMA 3K35A 3PCTA 4NJEB 3C14C 5IRCD 4ETIA 1OGIA 1HSOA 2XUJA 1L5HB 1K8QA 5CK4A 4JV5B 2HL6A 2YZGA 3L43A 1VE5A 4AS1A 1EE1A 2K4MA 2RK4A 4JB3A 3WFZA 2YCBA 3RBAA 2CYAA 4ZV4A 5C8DA 1H3EA 4DR6B 2B34A 3NTQA 5EI5A 2PKYX 4QU0A 1LX6A 1WHTB 3DHYA 2ZR8A 3ST7A 2OV8A 3P45A 2BELA 2E1RA 3Q7RA 4JEIA 4JLNA 3IQZA 2D2EA 3O2SB 4J9VA 5DN9A 4JLPA 4NBVA 1B43A 2PN1A 3WGGA 4ENRA 1L2TA 2WMDA 3NTUA 1W46A 2C1EA 1UWCA 3GB9A 4IJ5A 4NZNA 4PZCA 5EP4A 1KZ7B 4ZYVA 1Y42X 2QBYB 3ABSB 5KYVA 2PUAA 4FMDB 2AR0A 2XOKD 3L46A 3L7IA 4TZ6A 3IP5A 4HI0E 4QFBA 3F7NA 3IOEA 1E89A 4ED9A 1GKLA 1ENZA 3CE6A 4H0FA 2W4IA 3THRA 5I7SA 1BJRE 4FYXA 1A8PA 4AL4A 5LXTB 5DASA 2ZDQA 3R5TA 2ISQA 4YQZA 3T4UA 2QOEA 2DFDA 1Z6AA 2FPGA 2RHDA 1ZO8A 2C4TA 2JGLA 2RGWA 3OZGA 1Y48E 4LPKA 1T9AA 4DIBA 4D5EA 2NZ8A 1YNOA 1U4OA 2FZGA 2C5AA 3QZUA 1FDSA 2M6KA 1CUBA 1YZLA 4NCNA 5HGXA 1FMJA 2VO1A 5JSHA 1K6XA 4DM3A 3RRYA 2EZUA 1N7IA 4PN7A 3PUXA 3UKDA 3PENA 4HH0A 1E79A 3P0IA 4MS1A 2FW0A 3HLKA 4YT4A 1CQIA 1BE8A 4LAFA 4UDXX 5I7FA 5KYYA 4WH0A 4WY2A 5GZ3A 3DWGA 4R71A 3KOMA 2XYPA 1KY3A 2FRDC 1W30A 1P39A 4Z4QA 4W5TA 2CHUA 4U7TB 2FOLA 3KJZA 4H35A 1NUPA 4RKEA 3WK9A 3QF7A 1EIZA 5ERXA 2XTZA 1UBTS 8OHMA 4FLEA 2PUHA 1AO3A 1EP9A 1UZMA 3I30X 3RTBA 4JZKA 2JIBA 1GG5A 1J21A 4O4LA 5TDHA 3MB8A 2BFBB 4EJSA 1P62B 4GQBA 1NV8A 4Y2QA 4B5KA 3VYTB 4Z5XA 2NU6A 3IKTA 3AB3A 3ZNOA 1Z5NA 1PJCA 1Z2PX 4DY6A 4E70A 3NHSA 3A11A 1ULBA 5T3UA 1XD2B 1X9HA 1Z0ZA 1N5JA 4F8EA 2IOYA 3ONNA 1NWHA 3IKVA 3CSSA 2JA1A 4LWZA 4HH1A 4PYRA 1GA1A 4AX4A 2PWYA 2CZGA 3D9QX 3FTPA 1O97D 3UICA 1BEEA 4EGAA 4KOEC 4F2GA 5E0OA 4YK7A 2A58A 5ADHA 3R1IA 4BCDA 4JBHA 4JL5A 2Y0BA 1VHJA 4FMCF 2EP8A 3PB3A 5BYBA 1X7WB 1VE6A 3LLVA 1C0PA 3MTEA 4MV7A 4MROA 4RD4A 2B82A 2BFCA 2O05A 5FUVA 1SG0A 2H17A 1GGNA 4R1SA 1U5AA 1X15A 1MHTA 3HADA 4CMHA 4P80A 1OZHA 2I0FA 3OJOA 1RABA 4BO2A 1VMIA 3TUZC 3UFBA 3SQWA 3GXBA 2Y67A 4HPWA 2FUNB 2GBPA 2GPAA 1L7EA 4MQFA 3V8RA 4DPLA 1Y7HA 3WAGA 2C9DA 2VP9A 3GRRA 4NZOA 4D4MA 1K8YB 1WW8A 4F8JA 3LPCA 4AN4A 2FW7A 1PEKE 3JD0A 3P32A 4O6VA 5HIAA 3KEFA 4I1IA 3LA8A 4NMHA 3LWDA 4BQOA 3QBDA 3LY5A 1GCIA 4EY7A 1ZXBA 4D3DA 4LSZA 4P33A 5A6VA 1L5HA 4F38A 5EXEA 3ND7A 2MCFA 5HKLA 2IJGX 4BLPA 1O95A 4RDHA 4K9LA 4OXYA 2WDPA 2YQZA 3UWSA 1XELA 1YQWA 4BQNA 5KNLA 4JLSA 3COPA 1XRQA 3A28A 2ZRNA 3VH3A 5KSYA 2P4EA 5A4FS 1H0KA 2WUEA 3SEQA 2JDID 3S7ZA 3OFJA 2XMDA 3RAEC 1ZQ1A 1N6NA 3GH1A 4CMEA 2BH2A 3TDNA 3G5AA 3WYEA 1MFZA 5TGTA 4F6CA 2C3UA 3S44A 5BSRA 4QO8A 4CL8A 5G02A 3JYOA 3SNKA 1GPKA 2Z0MA 1AO0A 1Q12A 4ND8A 1G21E 2I3DA 3DOOA 3OSZA 3FTCA 3K96A 3EGIA 3NHUA 1ACLA 2AH5A 2FLVA 3DO5A 4PLYA 1U0NA 3CRVA 1I36A 2I71A 3CRZA 4FOLA 3A1VA 4L7QA 4WE3A 2CEAA 4ZT6A 5ENZA 3KQLA 3E1GA 4TOIA 4RE5A 2PKCA 3QH4A 4O2AF 2FQWA 1HA3A 4H31A 1L4HA 2CN1A 2VXBA 4EVRA 3QQPA 3BWEA 4D92A 5F2KA 5D7BA 3QU9A 5LLTA 3C6KA 3NH6A 4AF7A 1I1OA 1KYYA 1S2OA 2PH1A 4JXXA 2ZTSA 4CMKA 2CHGA 1IZ8A 1R8XA 1Q1QA 2E18A 2JIZA 5B1IA 2PYDA 3C4JA 2IEDA 3AFIA 4Q3NA 5TXGA 2B4RO 3AEQB 4PO9A 5LMUB 1C3LA 1O0SA 3S4YA 1LVGA 1BDMA 3DXZA 3NBZC 3PSHA 2PZMA 4GZ3A 4C1BA 4ESHA 4OGKA 3AVUA 3G2QA 1M34A 4O4HA 721PA 3IBYA 5D86A 3AHIA 4HXEB 4U02A 1ZJJA 2B99A 1BDBA 3B1XA 4K6KA 3EYAA 4FOSA 4NQRA 1VGRA 3RD5A 3K2EA 2AYXA 3PDCA 4HAWA 2JCXA 2F3TA 3BGVA 4P7JA 5CH5A 1NNLA 1L4EA 2Q6LA 3SE0A 1KARA 4LQ4A 5SICE 2BFBA 1EIWA 2VPIA 5DBIA 3HP1A 3UJ7A 1W29A 2QPLA 3K16A 3LAWA 2RAFA 4D4GA 4ZCTA 3RVOA 2GN4A 1K3UB 3P2KA 4LVNA 4M83A 3HWSA 3U3OA 2G7MC 4MDEA 5J4HA 3MSXA 1MIOB 4KNVA 1XD2A 4IIGA 3EAGA 4O8ZA 2OGZA 2AFRA 1BCSA 3R74A 5FH9A 2XUKA 1RJWA 4DAEA 2QQFA 4TV8F 3T9EA 2WJPA 4Z4IA 2ZZMA 2G6TA 1V5FA 3SDSA 2VP2A 5F52A 2I66A 4G8CA 4OREX 3OFSA 4OP1A 4K6OA 1DXHA 3JWPA 2A3RA 2G77B 3N53A 4W7IA 1AY0A 3S8YA 2C03A 1WU7A 1Q11A 1T35A 3MXOA 4JT8A 3C3DA 1HTTA 1RPNA 2QL9A 1E1RA 4LUCA 4RVCA 3TE6A 3TTTA 1ESZA 1SG6A 1AQIA 5ALFA 3ROXA 1WETA 2GJKA 1T8RA 1IY8A 4NMMA 4C06A 4L4ZA 2O6HA 1NXWA 4EG4A 1BOOA 5HKAA 4LJYA 4Z8YA 2IYEA 3CO0S 2B0JA 2QZZA 2R2GA 3DKRA 2ZJ5A 2GN8A 2ZYHA 1UK6A 1A1VA 1UMDA 5E9JA 2GPWA 3ZKAA 4F0JA 5HCNA 1R74A 4A2CA 4LHSA 2NWQA 4RY0A 1D7AA 2QTGA 2GD1O 4V0NA 2W6JD 1U1EA 3O8OB 4Y2UA 3QVUA 3PR2B 1I3CA 1ARZA 2DKNA 2I6UA 2OFXA 5FL3A 1B23P 4FJ1A 4POOA 4CVNA 1CUWA 2ODBA 4AX8A 3DMRA 2OCPA 4IMIB 3L07A 4ISCA 4JGIA 1DAPA 4F5ZA 4ZDKA 2JLZA 1ADFA 4C4PA 3NM5A 1T91A 4LBWA 4DQUA 1S3FA 2QMHA 2QLFA 4YQFA 3F6RA 3I1JA 1OYWA 4D8WA 2ZOSA 1WSWA 4P9NA 3OIWA 1I10A 4IMJB 2J3LA 3EW7A 2E0IA 3AUYA 1ZR4A 4G1FA 1XF9A 3W06A 3MPUA 2HJHA 2V7XA 3KKQA 3T3OA 3D0RA 3EEFA 1J0DA 4I8IA 5KDLA 1S1CA 2J67A 3T7CA 2Q41A 3LM8A 2CUTA 3R5HA 1LK5A 3GMIA 4AJKA 3P97A 5J4KA 2MMGA 1NMYA 2OAP1 2WHRA 3CPHA 3GGJA 5C5EA 4D3SA 2BM1A 4Z7OB 1IOZA 4FEGA 4FNGA 1WV1A 5IU6A 3QELB 5G0VA 4DLNA 1DEKA 2D00A 3A6KA 3NHZA 1PJRA 4NEGA 4P0PB 2JBHA 4GR5A 1KS9A 1M7HA 3ANLA 3GK3A 3TOCA 1ZUNB 4JYPA 4UUAA 3SC2B 4YCBA 1SNYA 1LRLA 2Y77A 4XARA 3UXEA 2OZLA 2NXJA 3K9NA 2ORIA 1EEXB 1JMYA 5BNFA 5REQB 3UK0A 3WMGA 5BOSA 3FYSA 3PFGA 3ZPXA 2PUGA 4KP7A 5JANA 3EZGA 1NNI1 1IUNA 2LNDA 3OHPA 4L8YA 5FP0A 3TSCA 1QRUA 1E2PA 3K5IA 1AC5A 3HSKA 1T24A 4NFLA 1RC8A 2C59A 5JCPA 3OP1A 4NFYA 4H7FA 3TGLA 5JH7B 1OKKD 3L84A 3OWHA 4JVLA 4OATA 4N7BA 1NV9A 4UUNA 3TJRA 1U2SA 3GN2A 3KZKA 2YVKA 3DZKA 3G82C 4JI5B 3WR5A 4EZBA 1QYXA 4I5GA 1DTSA 4OGGA 5K6AC 1VJRA 3CLUD 3O83A 1G3IA 3NCTA 1GXSB 3RBZA 5BO5A 1RXUA 3L02A 2QX4A 1CS4C 4GFDA 4FC6A 3FNFA 4NJOA 4MW1A 4ESOA 3IEVA 4YJFB 2C54A 4DCUA 5K8JB 3RQIA 1GOTA 1GKKA 2RIPA 4WLNA 4BB0A 2R8EA 4E3WA 4MOWA 3MWLA 2WM3A 1HKHA 1T3HA 1YVUA 3WGMA 1T8YA 3GGCA 4ZCIA 3L0SA 5CA0B 5JALA 3LKDA 4MRMB 3WGOA 5LQJA 3BREA 5EJMA 1MTZA 3DLIA 5KQPA 2O0MA 1G0OA 4AO6A 4TMKA 4HH3C 3G6KA 3AY7A 1RRPA 3R3VA 1K27A 1WUTA 4DCTA 3H5VA 1JA0A 3L6UA 1DTWB 2P69A 2QRNA 3CLSD 4BMDA 5KJ1A 1UJ2A 4OV6B 3ZHQA 2I7DA 3TKLA 1TAUA 4F45A 2H00A 1J56A 2FPIB 2XX3A 1NF2A 1ZJ5A 3GEGA 3RNOA 3RYFB 1EVLA 3OEYA 4NBRA 1V37A 1BFKA 3CLKA 3MQ4A 5A71A 4C01A 2ZYRA 3NKLA 1KZYC 2AC2A 2RGUA 4Q3KA 5E2IA 2ZIFA 5HTKA 1CZNA 4IKEA 3X2EA 1XTQA 3LDGA 3RU3A 3VRHA 3IIMA 4WX2B 2BHTA 3BXOA 5LKRA 1ZWKA 1EVIA 3Q7TA 5BW6B 1E5LA 3W7VA 3GZ4A 4JQZA 4K0RA 4RQTA 4AIIA 4REMA 2HWYA 3KYJB 5G40A 2QMEA 3VDNB 1WCXA 3VMMA 4PX2A 4HQ6A 3TRKA 1P6XA 2EX0A 1Y6FA 2VTKA 2XGSA 5K0ZA 2JGMA 1EHCA 1NJFA 4Z1MA 5JD6A 2OSBA 4RORA 4X24A 3KD2A 2DBYA 4KPYA 2K7ZA 1TIKA 3IQEA 4V02A 3TKYA 3THWB 1OH5A 2HYIC 3DTNA 4M89A 5CITA 1APBA 3TCXB 2RAPA 4UU8A 1PJ3A 4Y1RB 3PRHA 2XCIA 3AQIA 3CH7A 1XQ6A 4QT0A 4ER0A 4RXTA 1E8MA 2EARA 1SVOA 3FUUA 3LRXA 5AKKA 3CQ9A 2PS1A 1YB4A 2GKGA 3WYNA 1TEHA 1GR1A 2FTKE 2GUGA 4CM4A 3N7TA 2SICE 4GXRA 2X4GA 3EZ7A 1KY2A 1L7MA 1OU4A 2Y8EA 3EASA 4WEQA 5G1NA 3RUCA 3WGJA 1N77A 2HNKA 1XNGA 1XNHA 3DF9A 3L4BA 3ANYB 2G5GX 3LT1A 3OM8A 4E2YA 2QW0X 5K0NA 1H3NA 3DF7A 4DC0A 4ENTA 2IP4A 2I6SA 4B4UA 4BTLA 5B6IA 3RVJA 4IDDA 3IYLW 1KS2A 1L4UA 1T2UA 3QVKA 4INZA 5A3VA 4B32A 4HAXA 3QKSB 3D3EA 5C3UA 1NUUA 1CXZA 1LW6E 1PL8A 2J09A 3JWHA 1HTWA 3Q2KA 4NBUA 4X1KA 3H5OA 5HX7A 2JH9A 2J5XA 3GJ6A 4N7JA 3UA3A 2IYQA 2JGNA 3FCOA 2BSAA 4WPGA 3PXUA 2OGSA 2XTJA 4B3XA 3QBTA 2WAXA 5DT9A 1SU4A 2J0UB 4UHBA 5ALDA 2WB4A 3FGPA 2I62A 2XITA 1XTJA 3V4RA 3KQMA 3PNMA 1DIAA 5F7JA 1ZIXA 3K9CA 3BWYA 4P83A 4CKXA 3F4KA 4YRZA 2XB4A 4ZXPA 4CFSA 2G1JA 4OMFG 4EA7A 2AE2A 3P5SA 2XCLA 4UOQA 1W5TA 2DF8A 3UGQA 2CL7X 1H1LB 1UC9A 2LIPA 3NIFB 1BU5A 3OJWA 4G41A 4E09A 1Z15A 4C3VA 1I30A 3WL7A 4NU5A 4K9KA 3GP8A 4WZAE 3QOYA 1AZTA 4ARUA 2YJTD 2YVUA 3VNVA 2X14A 3GVCA 5GVRA 1PFVA 4Z4EA 2H8KA 4NAHA 1BGWA 2QUJA 5TF4A 2XMBA 3PQ8A 1M2GA 1YCDA 2O7SA 3JQFA 2IXBA 4ZO8A 3TLEA 1HYQA 1QGOA 4DFDA 3MWJA 2FGJA 1C7ZA 2HA0A 2HBYA 1ZCAA 2BN4A 2FMFA 3WYAA 5FX2A 1N2IA 1GAQA 1DAKA 3PV0A 4W9NA 4EI2A 1TTTA 4FQ8A 4MCJA 1A9XA 2HK7A 4MRMA 5ALYA 4G6ZA 4X85A 2B5VA 1QLHA 4DIKA 2QTHA 2PZKA 1IHOA 3HUEA 1Y80A 3E03A 3JQDA 3ZX5A 4KEAA 4PFKA 2QTWB 1A5BB 1YOBA 2RH4A 3H3XA 1VRWA 2C4HA 2QIOA 3PDIB 4WNCA 3ZBTA 2W8ZA 3REQB 4A8PA 1KHTA 2RIRA 2FOIA 3N0WA 2FKAA 1BRMA 2F3RA 2CLMB 4NY1A 4P2GA 1V95A 2X6QA 4G0NA 1NTRA 4WMLA 2PUBA 2ZXUA 4OQDA 1N3BA 3WRYC 2DLCX 5KYKA 5U9CA 5THKA 4YMGA 2PWZA 4ZDJA 1SC3A 1E2DA 2Z9DA 4MKRA 4MGKR 1GO2A 4EARA 5KTKA 4CG2A 1RSZA 4WY8A 3OAAA 1OAKA 4KZPA 4BE9A 1GFZA 4PG4A 5F5LA 1GPUA 2NUPA 4IR7A 3B7GA 1AKEA 4YYZA 1NP6A 3FHLA 1HUQA 2WSMA 4E5YA 3I83A 4G5HA 1QB7A 3A14A 2O7NA 4LN1A 2EP7A 5SV2A 1QFJA 3V1YA 3DEIA 1C3VA 1SCQA 1AB6A 2JKZA 3PE3A 3TL2A 3WZLA 2NOAA 2NTYC 3NO4A 4MUBA 5DBOA 1LFAA 4A0FA 3D0QA 1E6KA 2V7UA 2DSTA 3FF4A 3DMFA 4BNYA 5KTOA 3THYA 3GDHA 5B2FA 1TMYA 2BBTA 2PXAA 3WL6A 5AJWA 1Z18A 1XPUA 3AUTA 3EWAA 1VKRA 1BOFA 4NVRA 4LF9B 1M2VB 2IPMA 3MBIA 4OB7A 4XYMA 5JY6A 4Y1RA 4RM2A 2GA9A 4BUZA 1X3SA 1Z4QA 2B1JA 1HT3A 5AKIA 2FSFA 1LY1A 1G5PA 1OI3A 1QHFA 1N0UA 3EXG1 3QUBA 2WOJA 4YJ3A 3TTYA 4I4TB 2YWJA 3LVBA 1YJAA 2EL9A 4KVZA 4QO7A 1Z4MA 2NO4A 2V9PA 2ZTHA 3CJTA 3EMDA 4PPGA 5DU2A 2QYOA 1CUSA 3BCRA 1PTKA 1V9LA 4TSFA 3BT7A 1IE3A 3VZSA 1VZ2A 2VUHB 4Y2PA 5HVNA 3T5CA 1NOIA 4CIWA 1WF6A 1LPAB 1GPBA 1L7XA 1ADJA 3BBLA 3WI7A 3ZK8A 3KG2A 1ZX1A 4Q15A 1WSBA 2KSQA 2VK2A 3C1TA 3Q85A 3L4KA 4BX0A 4AJLA 5CT4A 5BXQC 1N3LA 2CV2A 1KH2A 1XAGA 5E6SA 3ZY5A 2ZIZA 3CR7A 5L3SB 3M3DA 3ZXSA 3HP4A 4HNAB 5F2NA 5CBPB 4QUIA 2ZKIA 3DSRA 1V5GA 1PR1A 3AJAA 3IURA 4NMXB 2NVOA 4ZQFA 1ZINA 3ZTWA 3I37X 3ODPA 1ID1A 2Q3MA 4GX0A 1S2LA 4MYDA 2AXPA 1JV2B 2OVFA 4H4CA 4UXIA 1TK9A 4MGIR 1N1MA 2AL7A 4AUEA 3CCCA 1XQYA 1FZQA 1X1DA 3IEIA 4MQMA 4XKJA 4ARIA 4MKFA 8GPBA 2QZJA 3RTCA 3GPDG 4MCIA 4YRCA 1AZLA 1XDZA 1EDBA 2BR4A 3TMKA 3WRVA 5DWQA 2A0WA 1TMKA 4JIMA 1T25A 1PZGA 4FKZA 1R10A 3BOSA 1WZEA 4GC9A 4D3FA 1V2HE 10MHA 3RADC 3B52X 2G1UA 2RJOA 4UTXA 1U0EA 1YULA 4G5YA 4M60A 3E70C 3KLNA 2WYVA 3WJAA 2OECA 4FYKA 2WU0A 5LP6A 2A5YB 2OK7A 3B6MA 4M0LA 4JSRA 3DE0X 4KDRA 5IULC 3NC0C 1QQ5A 5LLDA 3QPAA 2X9VA 2FQXA 3D8RA 5AM5A 5F9FA 1MMFB 4H2DA 2ZB2A 3SKXA 1GHTA 1SXJA 4RK5A 3LKBA 4NK4A 3T3PB 4DV4B 2W42A 1NSFA 4J7UA 5EJ6A 3M6XA 3HKDB 1XAHA 3K1JA 2F55A 3UBTA 3I2JA 4NYJR 1K4YA 5I9SA 2QD3A 2ODQA 2E7ZA 4O63O 4AY4A 3K9FC 4DLTA 3HXOA 4UEKA 2G70A 2XCUA 3HH8A 5EEHA 4DTIA 4IRXA 1J0CA 3RSFA 1E6UA 1PT9A 1MEJA 3DWIA 2QTVA 3PIRA 3AZPA 3AVWA 3LHDA 4CEHB 3GJ5A 4MA5A 4Y2TA 2IFTA 4ZQGA 4N48A 1FXSA 3PEWA 2ZI7A 3EIWA 1ZJWA 5AW8A 3GX1A 1J33A 5K01A 2GI4A 1NVFA 3FY4A 3KWJA 4UJ3A 3JRXA 3HKBB 2COUA 5CVDA 1MAAA 4H6VA 3NAZA 4H59A 3ULKA 5A02A 1QU3A 3ILYA 3AW9A 3VHRA 4DLYA 2CVOA 2ZWVA 3B5JA 3M4YA 1XTKA 2E4ZA 3RFUA 2NSDA 3ZV3A 4IJVA 4NIMA 1IOVA 5LVAA 1F06A 3QXXA 1UWVA 4X65B 5AKEA 4D8VA 1Z82A 1OIXA 2YMPA 4AO7A 3B6IA 3M5PA 3Q2OA 4CM7A 1T1JA 1ZGHA 4L8WB 1NASA 1Z2EA 4A8HA 4F85A 5B55A 3VA7A 3ROGA 5K03A 4ZVSA 1CLUA 4EVSA 3N2KA 4XQEA 3RHSA 1TT5A 1NXSA 2GHRA 2SNIE 4X7RA 1O2DA 4AULA 1M5TA 4R0NA 1CY0A 3UMCA 2ZSUA 4ZHQF 1MT0A 1Z26A 1S3GA 4LCEA 2G8NA 2RB5A 2EAUA 3B1KA 1M1YE 1H4TA 4XA8A 1G3QA 2G0AA 2G07A 5DTEA 5AVWA 4L85A 4NDZA 4I4TA 1E1CB 3HEBA 1YA4A 4PHFA 4UTVA 1QHNA 1HFWA 3BKWA 4DDKA 3PNKA 1HYEA 3WFJA 3CB2A 2YHAA 4DSAA 1KEZA 3Q0IA 1G19A 2PX0A 2WFLA 5EINA 1EZ1A 3WL8A 4CM3A 4P2BA 4GBJA 4U5QA 4GU5A 5CVVA 3FOEC 1PFWA 4HMQA 4J29A 4D79A 2PX5A 3DHWC 1NKTA 5DT2A 4ZN6A 3LCUA 1A95A 4I1RA 5JXGA 3CS3A 5DM2A 5JAUA 3HDVA 3QFHA 5ALPA 2UZAA 3G2HA 4MA4A 4Y9UA 2XUGA 2MU1A 1K8ZB 1WR8A 1QPGA 1ZIOA 3K15A 2CXTA 4UASA 1VGVA 3DLCA 5EHZA 4G37A 1B0UA 4Q37A 1JX6A 3MB5A 3RSGA 4FBGA 1JQDA 1C7FA 1YZNA 4BV2A 3E7WA 4MS4B 1ZZEA 3ILVA 2R1VA 1ZRSA 2R1ZA 2W0SA 5IWCA 5IKPA 3T5GA 2OCIA 3C45A 3FZYA 4UM9D 1N7HA 1F2UB 1RKUA 1ECFA 3ZZNA 1BAPA 4DTCA 2A9JA 2OCLA 1SUPA 1F6DA 1M33A 1Z63A 3M6AA 5EE1A 2JCSA 3ZQKA 1GNLA 5HJ5A 1XTIA 4MICA 3LYAA 1YIAA 2F7SA 3IIIA 1RPTA 2N42A 4BAGA 5AQEA 2MHCA 1V1RA 1F4LA 4AYWA 3KFXA 4P35A 2AF4C 4RY8A 4Z9YA 1GSOA 4BRUA 2J07A 1TVMA 3CXUA 3IAM6 4CF6A 4DLBA 4HB0A 5FFNA 1MX3A 3VISA 5JJIA 5LZ4A 2NYUA 2YXEA 1FW6A 2VNKA 3ZU6A 4DQVA 5BORA 1G9SA 1KFJB 1UC5B 1TT7A 3FWNA 2BKXA 4KDEA 4KO1S 5FUWA 2OQVA 1K5GA 1J97A 3S28A 2PA0A 3PFIA 3QY0A 4UVEA 4IGFA 5K0GA 4FZ5A 1DDOA 2BKAA 2Q8PA 4G5QA 1RLIA 4HUQB 3ZZMA 1KJWA 3ETJA 1A96A 4GXTA 4LTDA 3UUWA 1M73E 4RVHA 3HZZA 3VR2A 3GOHA 1V39A 3VKVA 4MWEA 2ZYWX 2DETA 3FMPB 3NTOA 3I8OA 3BILA 3R20A 1O4WA 2ADOA 1IL0A 3KSRA 2LCQA 3AFOA 4MARA 3L7DA 3VAAA 5KC8A 5T41A 1UBCA 3ONEA 1MQAA 3TZBA 3VR6A 1I7SB 1BDJA 4FK8A 3JX9A 4DDTA 3TNFA 3ROKA 2AZMA 4H17A 2G9ZA 3HNPA 3SHTA 2YVQA 1T6NA 4F4JA 3OZDA 4EWLA 1M54A 3TQRA 5DTIA 2A84A 5DP2A 1KYQA 3UUGA 3EFHA 1K89A 1GUBA 1GPH1 2QNIA 3QPWA 3L82B 1X92A 2VZ0A 2GESA 6REQA 1RXSA 4QXRA 3F5MA 2XOKA 4IVQA 3CVJA 4CR8A 1JILA 4Q1FA 4J0IA 2HIHA 3RYIB 4G0XA 3TTXA 1B76A 3SDBA 3WB1A 5JADA 1JIUA 4OP3A 5JDCA 4U7DA 3LVRE 5FUMA 2FJ0A 1GRCA 4US1R 4JCOA 5EKXA 1VCHA 4I2NA 4TGLA 3HTXA 4H6WA 1YJBA 2R3SA 2Y1EA 2QTAA 2NU8B 3HDGA 4EDFA 3IBFA 3KR1A 3CISA 4H27A 2PK3A 3X1XA 2PT6A 1EP3B 4RETA 5FBQB 4L95C 4HNUA 4BAZA 1KYVA 3OZRA 1VG9B 1XU7A 2XYQA 3QVGA 1XZMA 2YXLA 3EZFA 3DMTC 5LB4A 2CF6A 1P7PA 1GITA 4LDRA 3SAJA 4I9FA 1HEIA 5JS1A 4L76A 5DULA 2D5LA 1VPWA 3JARB 1CS0A 2BM8A 3OZAA 5J3JA 2PZJA 4X60A 2AOWA 3C5EA 5MN5A 2R6JA 4HFRA 4ZTUB 4QUBA 3MRXA 4GLFA 1RS0A 1YJCA 2XEDA 4C2UA 3H7AA 3BULA 4AC9A 1EYZA 5FA5A 1FJXA 4G84A 3TD9A 1FP7A 1ODIA 1WZNA 1YS9A 2FG6C 3GW8A 4I9HA 4UHFA 1T0PA 3L5KA 1N0VC 3C5HA 2JFYA 2PRJA 2E6UX 5JC8A 1Y1TA 3TD6A 4TQGA 1L8LA 1AN9A 4F3NA 1XG5A 3P9IA 2C42A 2GZHA 4HLNA 2BGRA 1GV1A 1HE8B 1KIFA 2DX7A 3I92A 3MWFA 2E5FA 1JQAA 1NZFA 1TZMA 3BFVA 2G67A 3HYNA 4RHCA 1E9VA 1HZJA 3ITNA 1T2FA 3O8NA 5DHAA 3U6KA 2YWBA 3K9HA 3PP8A 4AKHA 2IXAA 2V5AA 1PW7A 3CEHA 4KK3A 3I0NA 4OHOA 4PTZA 4XD7D 5J47A 4J9UE 2CFIA 2GM3A 3BERA 2XY4A 3UPDA 1E2FA 5JSKA 2PGOA 3V4VB 5LZ7A 3GLIA 1F2UA 1U2DA 1VG8A 2M1XA 2TYSB 3EHEA 1N78A 4CM8B 3TSYA 2WAYA 2R87A 4CZ2A 1GLVA 5K51A 2IC5A 3AR4A 3KXIA 1XBTA 3HCRA 1XCLA 3EG5A 3QYFA 5ALUA 1A9YA 2C8KA 3Q7IA 2A9QA 5JO0A 3TR5A 1U81A 1UC4B 3I52A 4OI2A 4OG2A 3ZS9A 4NV3A 1PT8A 1V7CA 3K6SA 4ROSA 1C3JA 2GSWA 3JATB 4I9UA 3FAKA 4MQUA 1W0CA 4WLEA 2R8ZA 3JVIA 1KO7A 2NYAA 1JHPA 2H1RA 3T7JA 2JIOA 5H9WA 1QBGA 4OO3A 4ZO9A 3W90A 1ORWA 3K0FA 2UVPB 4QUKA 5JIBA 5KOJB 3UMYA 2EGHA 2IZ6A 4ZI5A 4QDZA 1JSZA 5H16A 3TX2A 3BIWA 4IUDS 4K6CA 4MNTA 3C7CB 3DBVO 2CCGA 2N46A 2X0KA 4QJIA 4EUSA 1VP3A 1U5BB 4HUQA 3QE9Y 4P3OA 3BAZA 2X8JA 4UNIA 4MWTA 3I61A 1BEUB 1UINA 2FSVC 3HWX1 4JAVC 2QR2A 4OQYA 4OVKA 1LNZA 3U1TA 5B12A 1U8UA 5KOYA 5JDIC 8LDHA 2GCIA 1Z6ZA 2VHYA 3C5VA 4LJ8A 3GARA