The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
351
|
structure length |
314
|
Chain Sequence |
SAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIENVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Dna binding protein
|
molecule keywords |
ADENOVIRUS SINGLE-STRANDED DNA-BINDING PROTEIN
|
publication title |
Conformational change of the adenovirus DNA-binding protein induced by soaking crystals with K3UO2F5 solutions.
pubmed doi rcsb |
total genus |
84
|
structure length |
314
|
sequence length |
351
|
ec nomenclature | |
pdb deposition date | 1996-03-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02236 | Viral_DNA_bi | Viral DNA-binding protein, all alpha domain |
A | PF03728 | Viral_DNA_Zn_bi | Viral DNA-binding protein, zinc binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Adenovirus Single-stranded Dna-binding Protein, domain 1 | Adenovirus DNA-binding, N-terminal domain | ||
Alpha Beta | Alpha-Beta Complex | Adenovirus Single-stranded DNA-binding Protein; domain 2 | Adenovirus DNA-binding, C-terminal domain superfamily/Adenovirus DNA-binding, zinc binding domain |
#chains in the Genus database with same CATH superfamily 1ADU A; 2WB0 X; 2WAZ X; 1ADV A; 1ANV A; #chains in the Genus database with same CATH topology 1ZAT A; 1ADU A; 2WB0 X; 2HKL A; 2WAZ X; 1ADV A; 1ANV A; #chains in the Genus database with same CATH homology 1ADU A; 2WB0 X; 2WAZ X; 1ADV A; 1ANV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...