The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
102
|
structure length |
102
|
Chain Sequence |
GHRIPEETIEAIRRGVDIVDVIGEYVQLKRQGRNYFGLCPFHGEKTPSFSVSPEKQIFHCFGCGAGGNAFTFLMDIEGIPFVEAAKRLAAKAGVDLSVYELD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transferase
|
| molecule keywords |
DNA PRIMASE
|
| publication title |
Structure of the zinc-binding domain of Bacillus stearothermophilus DNA primase.
pubmed doi rcsb |
| source organism |
Geobacillus stearothermophilus
|
| total genus |
27
|
| structure length |
102
|
| sequence length |
102
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.7.-: |
| pdb deposition date | 1999-09-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01807 | zf-CHC2 | CHC2 zinc finger |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | DNA Primase; Chain A | Zinc finger, CHC2-type domain |
#chains in the Genus database with same CATH superfamily 1D0Q A; 2AU3 A; #chains in the Genus database with same CATH topology 1D0Q A; 2AU3 A; #chains in the Genus database with same CATH homology 1D0Q A; 2AU3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
