The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
223
|
structure length |
223
|
Chain Sequence |
MKIDITDYNHADEILNPQLWKEIEETLLKMPLHVKASDQASKVGSLIFDPVGTNQYIKDELVPKHWKNNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYPFLLNNTVRSELFHKSNMDIDEEGMKVAIIITKGHMFPASNSSLYYEQAQNQLNSLAEYNVFDVPIRLVGLIEDFETDIDIVSTTYADKRYSRTITKRDTVKGKVIDTNTPNTRRRKRGTIVTY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase/dna
|
| molecule keywords |
DNA (5'-D(*TP*AP*TP*TP*AP*TP*AP*GP*AP*TP*CP*TP*AP*TP*AP*A)-3
|
| publication title |
Understanding the immutability of restriction enzymes: crystal structure of BglII and its DNA substrate at 1.5 A resolution.
pubmed doi rcsb |
| source organism |
Bacillus subtilis
|
| total genus |
68
|
| structure length |
223
|
| sequence length |
223
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.21.4: Type II site-specific deoxyribonuclease. |
| pdb deposition date | 1999-12-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09195 | Endonuc-BglII | Restriction endonuclease BglII |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Restriction Endonuclease | Restriction Endonuclease |
#chains in the Genus database with same CATH superfamily 1BHM A; 3BAM A; 1SDO A; 1BAM A; 1D2I A; 1ES8 A; 2P0J A; 1VRR A; 3ODH A; 2BAM A; 1DFM A; 1ESG A; #chains in the Genus database with same CATH topology 5JHV A; 1FZR A; 4E5I A; 3MQ6 A; 2EWF A; 3BM3 A; 4E5E A; 4AWK A; 1M0D A; 4E5J A; 4F0Q A; 1DFM A; 4AWM A; 1BAM A; 4AWH A; 1KNV A; 5FDG A; 3WVP A; 4ZQQ A; 4AVQ A; 1M0I A; 2P14 A; 2XI7 A; 1DC1 A; 5D4G A; 4YYL A; 4E5G A; 1CFR A; 3MQY A; 3WVG A; 4AWF A; 5D9J A; 4CGX A; 2P0J A; 4CHC A; 4E5F A; 5DES A; 4ZHZ A; 4AVL A; 2E52 A; 3DW9 A; 1VRR A; 5CL0 A; 3BAM A; 5D8U A; 3WVH A; 4E5H A; 3DPG A; 1FOK A; 4CGS A; 3HW3 A; 3CAE A; 2GB7 A; 4OC8 A; 3HW6 A; 2XI5 A; 3DVO A; 5FDD A; 1ESG A; 4ZI0 A; 5DEB A; 3HW5 A; 3V1Z A; 5D2O A; 5I13 A; 2FOK A; 4AVG A; 1D2I A; 3ODH A; 3A4K A; 1BHM A; 4R28 A; 3N78 A; 1ES8 A; 4F0P A; 5JHT A; 2BAM A; 5CZN A; 5CGV A; 5D42 A; 3N7B A; 2PFJ A; 5CCY A; 1SDO A; 3HW4 A; 3V20 A; 4E5L A; 5EGA A; 3EBJ A; 3WVI A; 4AWG A; 2FQZ A; 3V21 A; 5DBS A; 3WVK A; 4NFZ A; #chains in the Genus database with same CATH homology 5JHV A; 1FZR A; 4E5I A; 3MQ6 A; 2EWF A; 3BM3 A; 4E5E A; 4AWK A; 1M0D A; 4E5J A; 4F0Q A; 1DFM A; 4AWM A; 1BAM A; 4AWH A; 1KNV A; 5FDG A; 3WVP A; 4ZQQ A; 4AVQ A; 1M0I A; 2P14 A; 2XI7 A; 1DC1 A; 5D4G A; 4YYL A; 4E5G A; 1CFR A; 3MQY A; 3WVG A; 4AWF A; 5D9J A; 4CGX A; 2P0J A; 4CHC A; 4E5F A; 5DES A; 4ZHZ A; 4AVL A; 2E52 A; 3DW9 A; 1VRR A; 5CL0 A; 3BAM A; 5D8U A; 3WVH A; 4E5H A; 3DPG A; 1FOK A; 4CGS A; 3HW3 A; 3CAE A; 2GB7 A; 4OC8 A; 3HW6 A; 2XI5 A; 3DVO A; 5FDD A; 1ESG A; 4ZI0 A; 5DEB A; 3HW5 A; 3V1Z A; 5D2O A; 5I13 A; 2FOK A; 4AVG A; 1D2I A; 3ODH A; 3A4K A; 1BHM A; 4R28 A; 3N78 A; 1ES8 A; 4F0P A; 5JHT A; 2BAM A; 5CZN A; 5CGV A; 5D42 A; 3N7B A; 2PFJ A; 5CCY A; 1SDO A; 3HW4 A; 3V20 A; 4E5L A; 5EGA A; 3EBJ A; 3WVI A; 4AWG A; 2FQZ A; 3V21 A; 5DBS A; 3WVK A; 4NFZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
