The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
61
|
structure length |
61
|
Chain Sequence |
DESFLCYQPDQVCCFICRGAAPLPSEGECNPHPTAPWCREGAVEWVPYSTGQCRTTCIPYV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase/hydrolase inhibitor
|
molecule keywords |
CARBOXYPEPTIDASE A2
|
publication title |
Structure of a novel leech carboxypeptidase inhibitor determined free in solution and in complex with human carboxypeptidase A2.
pubmed doi rcsb |
total genus |
10
|
structure length |
61
|
sequence length |
61
|
ec nomenclature | |
pdb deposition date | 2000-01-12 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Carboxypeptidase Inhibitor; Chain A | Carboxypeptidase inhibitor |
#chains in the Genus database with same CATH superfamily 1ZFI A; 1DTV A; 2ABZ C; 1ZFL A; 1DTD B; #chains in the Genus database with same CATH topology 2ABZ C; 3G2P A; 3G2M A; 3HVN A; 3PJV D; 1PFO A; 1ZFI A; 4BIK A; 1M3I A; 1DTV A; 1DTD B; 3G2Q A; 1S3R A; 3G2O A; 3IF8 B; 1ZFL A; 1M3J A; 3CQF A; 4HSC X; #chains in the Genus database with same CATH homology 1ZFI A; 1DTV A; 2ABZ C; 1ZFL A; 1DTD B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...