The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
SADQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Protein binding
|
| molecule keywords |
LATENT TRANSFORMING GROWTH FACTOR BETA BINDING PROTEIN 1
|
| publication title |
Solution Structure of the Third TB Domain from LTBP1 Provides Insight into Assembly
of the Large Latent Complex that Sequesters Latent TGF-beta.
pubmed doi rcsb |
| source organism |
Homo sapiens
|
| total genus |
9
|
| structure length |
75
|
| sequence length |
75
|
| ec nomenclature | |
| pdb deposition date | 2002-01-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00683 | TB | TB domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Extracellular Matrix Fibrillin | TGF-beta binding (TB) domain |
#chains in the Genus database with same CATH superfamily 2B0U C; 1UZQ A; 5JHW C; 1UZK A; 2W86 A; 1APJ A; 3B4V C; 3HH2 C; 1UZJ A; 1KSQ A; 2P6A C; 1UZP A; 3SEK C; #chains in the Genus database with same CATH topology 2B0U C; 1UZQ A; 5JHW C; 1UZK A; 2W86 A; 1APJ A; 3B4V C; 3HH2 C; 1UZJ A; 1KSQ A; 2P6A C; 1UZP A; 3SEK C; #chains in the Genus database with same CATH homology 2B0U C; 1UZQ A; 5JHW C; 1UZK A; 2W86 A; 1APJ A; 3B4V C; 3HH2 C; 1UZJ A; 1KSQ A; 2P6A C; 1UZP A; 3SEK C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
