The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
66
|
sequence length |
207
|
structure length |
201
|
Chain Sequence |
SDAMTTFLQRDEFAVTARVLGALFYYSPESHETAPLVQALLNDDWQAQWPLDAEALAPVAAMFKTHSEESLPQAWQRLFIGPYALPSPPWGSVWLDRESVLFGDSTLALRQWMRENGIQEPEDHFGSLLLLAAWLAENDRHHECEQLLAWHLFPWSSRFLDVFIDHAGHPFYQALGQLARLTLAQWQAQLIIPVAVKPLFR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
putative component of anaerobic dehydrogenases
|
publication title |
The 1.38 A crystal structure of DmsD protein from Salmonella typhimurium, a proofreading chaperone on the Tat pathway.
pubmed doi rcsb |
source organism |
Salmonella typhimurium
|
total genus |
66
|
structure length |
201
|
sequence length |
207
|
ec nomenclature | |
pdb deposition date | 2004-02-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02613 | Nitrate_red_del | Nitrate reductase delta subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | TorD-like | TorD-like |
#chains in the Genus database with same CATH superfamily 2IDG A; 3EFP A; 1S9U A; 2Y6Y A; 3CW0 A; 3U41 A; 2YJM A; 2XOL A; #chains in the Genus database with same CATH topology 2IDG A; 3EFP A; 1S9U A; 2Y6Y A; 3CW0 A; 3U41 A; 2YJM A; 3QNF A; 2XOL A; #chains in the Genus database with same CATH homology 2IDG A; 3EFP A; 1S9U A; 2Y6Y A; 3CW0 A; 3U41 A; 2YJM A; 3QNF A; 2XOL A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...