The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
186
|
structure length |
186
|
Chain Sequence |
MKIFFITSNPGKVREVANFLGTFGIEIVQLKHEYPEIQAEKLEDVVDFGISWLKGKVPEPFMIEDSGLFIESLKGFPGVYSSYVYRTIGLEGILKLMEGAEDRRAYFKSVIGFYIDGKAYKFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEKNALSHRGKALKAFFEWLKVNLKY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
hypothetical protein PH1917
|
| publication title |
Structures of dimeric nonstandard nucleotide triphosphate pyrophosphatase from Pyrococcus horikoshii OT3: functional significance of interprotomer conformational changes.
pubmed doi rcsb |
| source organism |
Pyrococcus horikoshii
|
| total genus |
58
|
| structure length |
186
|
| sequence length |
186
|
| ec nomenclature |
ec
3.6.1.66: XTP/dITP diphosphatase. |
| pdb deposition date | 2003-12-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01725 | Ham1p_like | Ham1 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 1ZWY A; 1B78 A; 3TQU A; 4P0E A; 4JHC A; 2I5D A; 2DVN A; 4P0U A; 2DVO A; 1ZNO A; 4BNQ A; 4OO0 A; 2AMH A; 1U14 A; 2ZTI A; 3S86 A; 2J4E A; 4F95 A; 1U5W A; 2PYU A; 2CAR A; 4HEB A; 1VP2 A; 1K7K A; 2Q16 A; 1EXC A; 1EX2 A; 4LU1 A; 2E5X A; 2DVP A; 1V7R A; 2P5X A; 2MJP A; #chains in the Genus database with same CATH topology 1ZWY A; 4UUW A; 2A9S A; 1B78 A; 3TQU A; 4CTA A; 4CT8 A; 4P0E A; 4JHC A; 2I5D A; 2DVN A; 4P0U A; 2DVO A; 1ZNO A; 4BNQ A; 4OO0 A; 2AMH A; 1U14 A; 2ZTI A; 3S86 A; 2J4E A; 4F95 A; 1U5W A; 5KVK A; 2PYU A; 2CAR A; 4CTA B; 5KOL A; 4HEB A; 1VP2 A; 1K7K A; 2Q16 A; 1EXC A; 4UUX A; 4CT9 A; 1EX2 A; 4LU1 A; 2E5X A; 2DVP A; 4UOC A; 1V7R A; 2P5X A; 2MJP A; #chains in the Genus database with same CATH homology 1ZWY A; 1B78 A; 3TQU A; 4P0E A; 4JHC A; 2I5D A; 2DVN A; 4P0U A; 2DVO A; 1ZNO A; 4BNQ A; 4OO0 A; 2AMH A; 1U14 A; 2ZTI A; 3S86 A; 2J4E A; 4F95 A; 1U5W A; 2PYU A; 2CAR A; 4HEB A; 1VP2 A; 1K7K A; 2Q16 A; 1EXC A; 1EX2 A; 4LU1 A; 2E5X A; 2DVP A; 1V7R A; 2P5X A; 2MJP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
