The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
163
|
structure length |
163
|
Chain Sequence |
SEVEIKFKIKLEDFLHTLNTFNPEFVRYEEQEDVYFEVPRPKLLRIRGVHNLKKYYLTFKEILDENNEEFYEVEFEIGDFEKAVEVFKRLGFKIQATIKKKRWVYKLNGVTLEVNRVEGIGDFVDIEVISDSPEEAKEKIWEVAKMLGLKEEDVEPRLYLELI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Conserved hypothetical protein Pfu-838710-001
|
publication title |
Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus
rcsb |
source organism |
Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
|
total genus |
38
|
structure length |
163
|
sequence length |
163
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2004-12-28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Hypothetical Protein Pfu-838710-001 | Hypothetical Protein Pfu-838710-001 |
#chains in the Genus database with same CATH superfamily 2ACA A; 2HZS B; 2EEN A; 3TJ7 A; 3N10 A; 5A65 A; 3SY3 A; 2HZM B; 3TVL A; 5A5Y A; 5A67 A; 2FJT A; 3TYP A; 3N0Z A; 3BHD A; 5A66 A; 5A64 A; 2FBL A; 3V85 A; 5A68 A; 3N0Y A; 2JMU A; 2GFG A; 1YEM A; 2DC4 A; 3C0T A; 4H63 R; #chains in the Genus database with same CATH topology 3G3O A; 2ACA A; 2HZS B; 2EEN A; 3TJ7 A; 3N10 A; 5A65 A; 3SY3 A; 2HZM B; 3G3Q A; 3TVL A; 5A5Y A; 5A67 A; 2FJT A; 3G3R A; 3TYP A; 3G3T A; 3N0Z A; 3BHD A; 5A66 A; 3G3U A; 5A64 A; 2FBL A; 3V85 A; 5A68 A; 3N0Y A; 2JMU A; 2GFG A; 1YEM A; 2DC4 A; 3C0T A; 4H63 R; #chains in the Genus database with same CATH homology 3G3O A; 2ACA A; 2HZS B; 2EEN A; 3TJ7 A; 3N10 A; 5A65 A; 3SY3 A; 2HZM B; 3G3Q A; 3TVL A; 5A5Y A; 5A67 A; 2FJT A; 3G3R A; 3TYP A; 3G3T A; 3N0Z A; 3BHD A; 5A66 A; 3G3U A; 5A64 A; 2FBL A; 3V85 A; 5A68 A; 3N0Y A; 2JMU A; 2GFG A; 1YEM A; 2DC4 A; 3C0T A; 4H63 R;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...