The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
80
|
structure length |
80
|
Chain Sequence |
AQVNIAPGSLDKALNQYAAHSGFTLSVDASLTRGKQSNGLHGDYDVESGLQQLLDGSGLQVKPLGNNSWTLEPAPAPKED
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein, metal transport
|
molecule keywords |
Iron(III) dicitrate transport protein fecA
|
publication title |
Signal transduction pathway of TonB-dependent transporters.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
14
|
structure length |
80
|
sequence length |
80
|
ec nomenclature | |
pdb deposition date | 2005-06-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07660 | STN | Secretin and TonB N terminus short domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bab) Sandwich | Phage tail protein beta-alpha-beta fold | Phage tail protein beta-alpha-beta fold |
#chains in the Genus database with same CATH superfamily 4M0H A; 2O5P A; 4AR0 A; 1ZZV A; 4JTM A; 2M5J A; 2W75 A; 2W6T A; 4G08 A; 2D1U A; 2W77 A; 4M0N A; 2W6U A; 2A02 A; 2W76 A; 3GR5 A; 2W16 A; 2W78 A; 3EZJ A; 2IAH A; #chains in the Genus database with same CATH topology 4UHV A; 4M0H A; 1WRU A; 2P5Z X; 2O5P A; 3ADY A; 4AR0 A; 2L4W A; 1ZZV A; 2WZP R; 4JTM A; 2M5J A; 2W75 A; 1K28 D; 3CDD A; 2W6T A; 4G08 A; 2Z6B D; 2D1U A; 2W77 A; 4M0N A; 2X53 1; 3GS9 A; 3OV5 A; 2W6U A; 3D37 A; 2A02 A; 4MTK A; 2W76 A; 3GR5 A; 2W16 A; 2W78 A; 1WTH D; 3EZJ A; 2IAH A; #chains in the Genus database with same CATH homology 4M0H A; 2O5P A; 3ADY A; 4AR0 A; 2L4W A; 1ZZV A; 2WZP R; 4JTM A; 2M5J A; 2W75 A; 1K28 D; 2W6T A; 4G08 A; 2Z6B D; 2D1U A; 2W77 A; 4M0N A; 3GS9 A; 3OV5 A; 2X53 1; 2W6U A; 2A02 A; 2W76 A; 3GR5 A; 2W16 A; 2W78 A; 1WTH D; 3EZJ A; 2IAH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...