The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
77
|
sequence length |
244
|
structure length |
244
|
Chain Sequence |
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase/dna
|
molecule keywords |
DNA (5'-D(*AP*AP*AP*GP*AP*T)-3')
|
publication title |
Mg2+ binding to the active site of EcoRV endonuclease: a crystallographic study of complexes with substrate and product DNA at 2 A resolution.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
77
|
structure length |
244
|
sequence length |
244
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.1.21.4: Type II site-specific deoxyribonuclease. |
pdb deposition date | 1994-10-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09233 | Endonuc-EcoRV | Restriction endonuclease EcoRV |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | ECO RV Endonuclease; Chain A | DNA mismatch repair MutH/Restriction endonuclease, type II |
#chains in the Genus database with same CATH superfamily 4PXG A; 2AZO A; 1SX5 A; 2GE5 A; 2B0E A; 1XHU A; 3E44 A; 1IAW A; 1KC6 A; 4RVE A; 1BGB A; 1BUA A; 2B0D A; 2AUD A; 1RVA A; 1EO3 A; 1BSU A; 2REU A; 1RVE A; 1RVB A; 1SUZ A; 3E42 A; 2GIG A; 1B97 A; 1BSS A; 1RVC A; 1EV7 A; 3E3Y A; 3E45 A; 1AZ4 A; 1TW8 A; 2GIH A; 2GII A; 1XHV A; 1B96 A; 3E41 A; 1EON A; 1AZ0 A; 1B94 A; 1EOP A; 2AOQ A; 1STX A; 3E40 A; 1AZ3 A; 1TX3 A; 1AZO A; 1SX8 A; 2AOR A; 3E43 A; 1B95 A; 5F8A A; 1EOO A; 1EO4 A; 2GIE A; 5HLK A; 2GIJ A; 2RVE A; 1RV5 A; 3EBC A; #chains in the Genus database with same CATH topology 4PXG A; 2AZO A; 1SX5 A; 2GE5 A; 2B0E A; 1XHU A; 3NDH A; 3E44 A; 1IAW A; 1KC6 A; 2F03 A; 4RVE A; 1BGB A; 1BUA A; 2B0D A; 2AUD A; 1RVA A; 1EO3 A; 1BSU A; 2REU A; 1RVE A; 1DMU A; 1RVB A; 1SUZ A; 3E42 A; 2GIG A; 1B97 A; 1BSS A; 1RVC A; 1EV7 A; 3E3Y A; 3E45 A; 2EZV A; 1AZ4 A; 1TW8 A; 2GIH A; 2GII A; 1XHV A; 1B96 A; 3E41 A; 1EON A; 1AZ0 A; 1B94 A; 1EOP A; 2AOQ A; 1STX A; 3E40 A; 1AZ3 A; 1TX3 A; 1AZO A; 1SX8 A; 2AOR A; 3E43 A; 1B95 A; 5F8A A; 1EOO A; 1EO4 A; 2GIE A; 5HLK A; 2GIJ A; 2RVE A; 1RV5 A; 3EBC A; #chains in the Genus database with same CATH homology 4PXG A; 2AZO A; 1SX5 A; 2GE5 A; 2B0E A; 1XHU A; 3E44 A; 1IAW A; 1KC6 A; 4RVE A; 1BGB A; 1BUA A; 2B0D A; 2AUD A; 1RVA A; 1EO3 A; 1BSU A; 2REU A; 1RVE A; 1RVB A; 1SUZ A; 3E42 A; 2GIG A; 1B97 A; 1BSS A; 1RVC A; 1EV7 A; 3E3Y A; 3E45 A; 1AZ4 A; 1TW8 A; 2GIH A; 2GII A; 1XHV A; 1B96 A; 3E41 A; 1EON A; 1AZ0 A; 1B94 A; 1EOP A; 2AOQ A; 1STX A; 3E40 A; 1AZ3 A; 1TX3 A; 1AZO A; 1SX8 A; 2AOR A; 3E43 A; 1B95 A; 5F8A A; 1EOO A; 1EO4 A; 2GIE A; 5HLK A; 2GIJ A; 2RVE A; 1RV5 A; 3EBC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...