The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDTDLIVPNLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural genomics, unknown function
|
| molecule keywords |
Lin0431 protein
|
| publication title |
Solution NMR structure of Lin0431 protein from Listeria innocua reveals high structural similarity with domain II of bacterial transcription antitermination protein NusG.
pubmed doi rcsb |
| source organism |
Listeria innocua
|
| total genus |
27
|
| structure length |
114
|
| sequence length |
114
|
| ec nomenclature | |
| pdb deposition date | 2009-10-18 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | mini-chromosome maintenance (MCM) complex, domain 2 | N-utilization substance G protein NusG, insert domain |
#chains in the Genus database with same CATH superfamily 1NPR A; 2KPP A; 4ESN A; 1NPP A; 4OBI A; 3LD7 A; 1M1G A; 1M1H A; #chains in the Genus database with same CATH topology 1NPR A; 2KPP A; 4A0T A; 4ESN A; 1NPP A; 4OBI A; 2YQ2 A; 3LD7 A; 1M1G A; 4A0U A; 1M1H A; #chains in the Genus database with same CATH homology 1NPR A; 2KPP A; 4ESN A; 1NPP A; 4OBI A; 3LD7 A; 1M1G A; 1M1H A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
