2KXOA

Solution nmr structure of the cell division regulator mine protein from neisseria gonorrhoeae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
MSLIELLFGRKQKTATVARDRLQIIIAQERAQEGQTPDYLPTLRKALMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division topological specificity factor
publication title Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 12
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03776 MinE Septum formation topological specificity factor MinE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1070.10 Alpha Beta 2-Layer Sandwich Cell Cycle; Chain A Cell division topological specificity factor MinE 2kxoA01
3KU7A 3MCDA 1EV0A 2KXOA
chains in the Genus database with same CATH superfamily
2GJHA 1EV0A 3KU7A 3MCDA 2KXOA
chains in the Genus database with same CATH topology
3KU7A 3MCDA 1EV0A 2KXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KU7 A;  3MCD A;  1EV0 A;  2KXO A; 
#chains in the Genus database with same CATH topology
 2GJH A;  1EV0 A;  3KU7 A;  3MCD A;  2KXO A; 
#chains in the Genus database with same CATH homology
 3KU7 A;  3MCD A;  1EV0 A;  2KXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...