2L6QA

New high resolution nmr structure of gpw (w protein of bacteriophage lambda) at neutral ph
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
MVRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Head-to-tail joining protein W (GpW) from bacteriophage orig
publication title Revisiting the NMR structure of the ultrafast downhill folding protein gpW from bacteriophage Lambda
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1580.10 Alpha Beta 2-Layer Sandwich Head-to-tail joining protein W, gpW Head-to-tail joining protein W 2l6qA00
1HYWA 2L6QA 2L6RA
chains in the Genus database with same CATH superfamily
1HYWA 2L6QA 2L6RA
chains in the Genus database with same CATH topology
1HYWA 2L6QA 2L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYW A;  2L6Q A;  2L6R A; 
#chains in the Genus database with same CATH topology
 1HYW A;  2L6Q A;  2L6R A; 
#chains in the Genus database with same CATH homology
 1HYW A;  2L6Q A;  2L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...