The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
80
|
structure length |
80
|
Chain Sequence |
GPGSMKIMSDNPFDDEDGMFFVLINDEEQHSLWPTFADVPAGWRVVFGEASRASCVEYVDQHWTDIRPKSLREKLASGQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Conserved hypothetical MbtH-like protein
|
publication title |
Solution structure of an MbtH-like protein from Mycobacterium marinum, Seattle Structural Genomics Center for Infectious Disease target MymaA.01649.c
rcsb |
source organism |
Mycobacterium marinum m
|
total genus |
9
|
structure length |
80
|
sequence length |
80
|
ec nomenclature | |
pdb deposition date | 2015-02-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03621 | MbtH | MbtH-like protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Rubredoxin-like | Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id |
#chains in the Genus database with same CATH superfamily 2KHR A; 4GR5 A; 2MYY A; 4GR4 A; 2GPF A; 2PST X; 1GH9 A; 5JA1 B; #chains in the Genus database with same CATH topology 2KHR A; 4GR5 A; 2JNE A; 2MYY A; 4GR4 A; 2GPF A; 2PST X; 1GH9 A; 5JA1 B; 2JRP A; #chains in the Genus database with same CATH homology 2KHR A; 4GR5 A; 2MYY A; 4GR4 A; 2GPF A; 2PST X; 1GH9 A; 5JA1 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...