2P1GA

Crystal structure of a putative xylanase from bacteroides fragilis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
229
Chain Sequence
VLSNGLGFVDTPYKAGTLEVDDTEDLIINCDEVDCTTFVEYALAMALCPQQEMQEGDFARNLQRIRYRDGKIDGYTSRLHYISDWINNAVRQGLLEDVTAAYSPFKQKLSLSYMSTHPELYKSLKNSPENVAQMAKYEKALSGKEVHYLPKDKLEPDGLPWIKNGDIIALTTNTPGLDVSHMGIAIYIKGQLHLLHASSKEGKVVVGKTALSQMLKDRKSLTGIRVLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative xylanase
publication title Crystal structure of a putative xylanase from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
total genus 71
structure length 229
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07313 DUF1460 Protein of unknown function (DUF1460)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3670.10 Mainly Alpha Orthogonal Bundle Putative xylanase fold Putative xylanase like domain 2p1gA01
2.30.260.10 Mainly Beta Roll putative xylanase like fold putative xylanase like domain 2p1gA02
2P1GA 4Q68A 2IM9A 4H4JA 4Q5KA
chains in the Genus database with same CATH superfamily
2P1GA 4Q68A 2IM9A 4H4JA 4Q5KA
chains in the Genus database with same CATH topology
2P1GA 4Q68A 2IM9A 4H4JA 4Q5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1G A;  4Q68 A;  2IM9 A;  4H4J A;  4Q5K A; 
#chains in the Genus database with same CATH topology
 2P1G A;  4Q68 A;  2IM9 A;  4H4J A;  4Q5K A; 
#chains in the Genus database with same CATH homology
 2P1G A;  4Q68 A;  2IM9 A;  4H4J A;  4Q5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...