The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
132
|
structure length |
128
|
Chain Sequence |
ENPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNSLKLDETDEFLMNLFFDNKKMLKKLAENPKYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Antiviral protein, hydrolase
|
| molecule keywords |
Interferon-induced helicase C domain-containing protein 1
|
| publication title |
MDA5 cooperatively forms dimers and ATP-sensitive filaments upon binding double-stranded RNA.
pubmed doi rcsb |
| source organism |
Mus musculus
|
| total genus |
53
|
| structure length |
128
|
| sequence length |
132
|
| ec nomenclature |
ec
3.6.4.13: RNA helicase. |
| pdb deposition date | 2011-09-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | phosphoenolpyruvate carboxylase, domain 3 | phosphoenolpyruvate carboxylase, domain 3 |
#chains in the Genus database with same CATH superfamily 3TBK A; 4A2Q A; 5F9F A; 5F98 A; 3TS9 A; 4A36 A; 3ZD6 A; 4ON9 A; 4AY2 A; 3ZD7 A; 4BPB A; 5E3H A; 5F9H A; 4A2P A; 4A2W A; 4GL2 A; 4I1S A; 2YKG A; #chains in the Genus database with same CATH topology 3TBK A; 5F98 A; 4AY2 A; 3ZD7 A; 5F9H A; 4I1S A; 3TS9 A; 3ZD6 A; 4GL2 A; 4A2W A; 4A2Q A; 4A36 A; 4ON9 A; 4BPB A; 5E3H A; 5F9F A; 1WP9 A; 4A2P A; 2YKG A; #chains in the Genus database with same CATH homology 3TBK A; 4A2Q A; 5F9F A; 5F98 A; 3TS9 A; 4A36 A; 3ZD6 A; 4ON9 A; 4AY2 A; 3ZD7 A; 4BPB A; 5E3H A; 5F9H A; 4A2P A; 4A2W A; 4GL2 A; 4I1S A; 2YKG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
