The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
113
|
structure length |
110
|
Chain Sequence |
HHHHMKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Rna binding protein
|
molecule keywords |
RNA-binding protein 25
|
publication title |
Crystal structure and functional characterization of the human RBM25 PWI domain and its flanking basic region
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
29
|
structure length |
110
|
sequence length |
113
|
chains with identical sequence |
B, C, D, E
|
ec nomenclature | |
pdb deposition date | 2011-12-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01480 | PWI | PWI domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | PWI domain | PWI domain |
#chains in the Genus database with same CATH superfamily 1X4Q A; 3V53 A; 1MP1 A; #chains in the Genus database with same CATH topology 2IW3 A; 2IWH A; 3V53 A; 2IX3 A; 1X4Q A; 1MP1 A; #chains in the Genus database with same CATH homology 2IW3 A; 2IWH A; 3V53 A; 2IX3 A; 1X4Q A; 1MP1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...