The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
282
|
structure length |
175
|
Chain Sequence |
PHMAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGDASKRKPYLPSDKQFLITRNVPCLRRAASLRTRTYDLSITYDKYYQTPRVWLTGYDESRMLLQPELVMEDVSQDTVTIEDHPHLPGKHASVHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ligase
|
molecule keywords |
Ubiquitin-like modifier-activating enzyme atg7
|
publication title |
Non-canonical recognition and ambiguous Ubl-loading of two distinct E2s by autophagy-essential E1, Atg7
rcsb |
source organism |
Arabidopsis thaliana
|
total genus |
44
|
structure length |
175
|
sequence length |
282
|
chains with identical sequence |
C
|
ec nomenclature | |
pdb deposition date | 2012-09-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF03987 | Autophagy_act_C | Autophagocytosis associated protein, active-site domain |
B | PF10381 | Autophagy_C | Autophagocytosis associated protein C-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Yope Regulator; Chain: A, | Yope Regulator; Chain: A, |
#chains in the Genus database with same CATH superfamily 4GSL C; 3VX7 B; 2DYT A; 4EBR A; 2LPU A; 3VX8 B; #chains in the Genus database with same CATH topology 1XKP B; 4G6T A; 2FM8 A; 1N5B A; 1RY9 A; 2P9I F; 2P9K F; 2DYT A; 3CXJ A; 2PLG A; 4GF3 A; 2P9N F; 3DXM F; 1K8K F; 2BSI A; 2BHO A; 2LPU A; 3EPU A; 3UKU D; 4XEI F; 4JMF B; 1K6Z A; 1JYA A; 1K3S A; 1L2W A; 2P9L D; 1XKP C; 3UKU F; 1TYQ D; 1S28 A; 4GSL C; 3ULE D; 3DXK D; 4AKX A; 2P9U D; 1TTW A; 2P9L F; 3RSE D; 2P9P D; 3VX7 B; 4H5B A; 1K3E A; 3UKR D; 4XEI D; 3DWL D; 1TYQ F; 1U2V D; 1JYO A; 2OD0 A; 2P9S D; 4JD2 D; 1K8K D; 2P9U F; 2XGA A; 3DXK F; 4JD2 F; 3KXY A; 3RSE F; 3ULE F; 3VX8 B; 2P9K D; 2P9P F; 2P9I D; 2MQD A; 2KC5 A; 4EBR A; 3UKR F; 2P9N D; 2BSH A; 3DXM D; 3DWL F; 1U2V F; 2P9S F; 3TU3 A; 2BSJ A; #chains in the Genus database with same CATH homology 1XKP B; 4G6T A; 2FM8 A; 1N5B A; 1RY9 A; 2P9I F; 2P9K F; 2DYT A; 3CXJ A; 2PLG A; 4GF3 A; 2P9N F; 3DXM F; 1K8K F; 2BSI A; 2BHO A; 2LPU A; 3EPU A; 3UKU D; 4XEI F; 4JMF B; 1K6Z A; 1JYA A; 1K3S A; 1L2W A; 2P9L D; 1XKP C; 3UKU F; 1TYQ D; 1S28 A; 4GSL C; 3ULE D; 3DXK D; 4AKX A; 2P9U D; 1TTW A; 2P9L F; 3RSE D; 2P9P D; 3VX7 B; 4H5B A; 1K3E A; 3UKR D; 4XEI D; 3DWL D; 1TYQ F; 1U2V D; 1JYO A; 2P9S D; 4JD2 D; 4JD2 F; 1K8K D; 2P9U F; 2XGA A; 3DXK F; 3RSE F; 3KXY A; 3ULE F; 3VX8 B; 2P9K D; 2P9P F; 2P9I D; 2MQD A; 2KC5 A; 4EBR A; 3UKR F; 2P9N D; 2BSH A; 3DXM D; 3DWL F; 1U2V F; 2P9S F; 3TU3 A; 2BSJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...