The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
54
|
sequence length |
217
|
structure length |
203
|
Chain Sequence |
ASHANINAFKEAVTKIDRVEINRRLELAYAYNASIAGAPALKDPYSVEYARMLEVKEQIGHVIIPRINQDIPIYAGSAEENLQRGVGHLEGTSLPVGGESTHAVLTAHRGLPTAKLFTNLDKVTVGDRFYIEHIGGKIAYQVDQIKVIAPDQLEDLYVIQGEDHVTLLTCTPYMINSHRLLVRGKRIPYVEKTVQKDSKTFRQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
molecule keywords |
Sortase family protein
|
publication title |
Structural basis for group B streptococcus pilus 1 sortases C regulation and specificity.
pubmed doi rcsb |
source organism |
Streptococcus agalactiae serogroup v
|
total genus |
54
|
structure length |
203
|
sequence length |
217
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2012-07-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04203 | Sortase | Sortase domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Sortase; Chain: A; | Sortase |
#chains in the Genus database with same CATH superfamily 1QXA A; 3RBJ A; 1QWZ A; 3FN5 A; 3RBI A; 4G1J A; 5GYJ A; 3O0P A; 2LN7 A; 4D7W A; 2RUI A; 2XWG A; 3TB7 A; 2WTS A; 3G69 A; 4O8T A; 4LFD A; 3RBK A; 2OQZ A; 3PSQ A; 5K9A A; 3RCC A; 1T2P A; 1T2O A; 2W1K A; 1RZ2 A; 2KID A; 4Y4Q A; 5GO5 A; 4O8L A; 5JCV A; 3TBE A; 5B23 A; 4D70 A; 5CUW A; 2KW8 A; 1IJA A; 1T2W A; 3FN7 A; 3RE9 A; 4UX7 A; 1NG5 A; 2W1J A; 3FN6 A; 3G66 A; 4O8L B; 4G1H A; 2OQW A; 2MLM A; 1QX6 A; #chains in the Genus database with same CATH topology 1QXA A; 3RBJ A; 1QWZ A; 3FN5 A; 3RBI A; 4G1J A; 5GYJ A; 3O0P A; 2LN7 A; 4D7W A; 2RUI A; 2XWG A; 3TB7 A; 2WTS A; 3G69 A; 4O8T A; 4LFD A; 3RBK A; 2OQZ A; 3PSQ A; 5K9A A; 3RCC A; 1T2P A; 1T2O A; 2W1K A; 1RZ2 A; 2KID A; 4Y4Q A; 5GO5 A; 4O8L A; 5JCV A; 3TBE A; 5B23 A; 4D70 A; 5CUW A; 2KW8 A; 1IJA A; 1T2W A; 3FN7 A; 3RE9 A; 4UX7 A; 1NG5 A; 2W1J A; 3FN6 A; 3G66 A; 4O8L B; 4G1H A; 2OQW A; 2MLM A; 1QX6 A; #chains in the Genus database with same CATH homology 1QXA A; 3RBJ A; 1QWZ A; 3FN5 A; 3RBI A; 4G1J A; 5GYJ A; 3O0P A; 2LN7 A; 4D7W A; 2RUI A; 2XWG A; 3TB7 A; 2WTS A; 3G69 A; 4O8T A; 4LFD A; 3RBK A; 2OQZ A; 3PSQ A; 5K9A A; 3RCC A; 1T2P A; 1T2O A; 2W1K A; 1RZ2 A; 2KID A; 4Y4Q A; 5GO5 A; 4O8L A; 5JCV A; 3TBE A; 5B23 A; 4D70 A; 5CUW A; 2KW8 A; 1IJA A; 1T2W A; 3FN7 A; 3RE9 A; 4UX7 A; 1NG5 A; 2W1J A; 3FN6 A; 3G66 A; 4O8L B; 4G1H A; 2OQW A; 2MLM A; 1QX6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...