The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
96
|
sequence length |
332
|
structure length |
332
|
Chain Sequence |
IMTKNQISSNYYKTVLPYKASKSRGLVVSNIYSRYDINELESGLMRVSQNKYSPDNYLFQEGQYLDKETLEKWLDRKSDKNPNGLNPASNGNGENRKPIYLAHILEQDYLKQTDKDTVALGGISIALAMNSVDYYQKEKYGDTYEQPISDSELLAQGKEMSATVLNRIRQTKGLENVPVTIAIYKQGARDAVAPGNYIAYATANGDSLSNWKDIDEKNYVLPSTESAKDHKTDNDNFLNFKKAIEDYYPNFTGVVGRGRYEDGQLAELNIDIPLQFYGEAEIIGFTQYVTDLVGQHIPKTADLQVNISTSDGPAALITRKANEDAATAHIYD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Signaling protein
|
molecule keywords |
Lmo1757 protein
|
publication title |
The crystal structure of a sex pheromone precursor (lmo1757) from Listeria monocytogenes EGD-e
rcsb |
source organism |
Listeria monocytogenes
|
total genus |
96
|
structure length |
332
|
sequence length |
332
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2012-10-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07537 | CamS | CamS sex pheromone cAM373 precursor |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | sex pheromone staph- cam373 precursor fold | sex pheromone staph- cam373 precursor domain |
#chains in the Genus database with same CATH superfamily 3IB5 A; 2QX2 A; 4HN3 A; 3N2Q A; #chains in the Genus database with same CATH topology 3IB5 A; 2QX2 A; 4HN3 A; 3N2Q A; #chains in the Genus database with same CATH homology 3IB5 A; 2QX2 A; 4HN3 A; 3N2Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...