4NG0A

Lar_0958 a cell surface adhesin from lactobacillus reuteri
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
MKVTYSGSDSKTYDGNPANFEPTTVQWSGLKGLNTSTLTSADFTWNTADKKAPTDAGKYTLSLNTTGEAALRKANPNYDLKTISGSYTYTINPLGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords LAR_0958 cell surface adhesin
publication title Structural and molecular insights into novel surface-exposed mucus adhesins from Lactobacillus reuteri human strains.
pubmed doi rcsb
source organism Lactobacillus reuteri
total genus 23
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.430.110 Alpha Beta Roll Ribosomal Protein L9; domain 2 Ribosomal Protein L9; domain 2 4ng0A00
4NG0A
chains in the Genus database with same CATH superfamily
4NG0A 1DIVA
chains in the Genus database with same CATH topology
4NG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NG0 A; 
#chains in the Genus database with same CATH topology
 4NG0 A;  1DIV A; 
#chains in the Genus database with same CATH homology
 4NG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...