The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
48
|
sequence length |
124
|
structure length |
124
|
Chain Sequence |
GSQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
molecule keywords |
Signal transducer and activator of transcription 3
|
publication title |
Impact of the N-Terminal Domain of STAT3 in STAT3-Dependent Transcriptional Activity.
pubmed doi rcsb |
source organism |
Mus musculus
|
total genus |
48
|
structure length |
124
|
sequence length |
124
|
chains with identical sequence |
B, C, D, E
|
ec nomenclature | |
pdb deposition date | 2015-04-28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transcription Factor, Stat-4 | STAT transcription factor, N-terminal domain |
#chains in the Genus database with same CATH superfamily 3WWT A; 1BGF A; 1YVL A; 4ZIA A; #chains in the Genus database with same CATH topology 3WWT A; 1BGF A; 1YVL A; 4ZIA A; #chains in the Genus database with same CATH homology 3WWT A; 1BGF A; 1YVL A; 4ZIA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...