The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
78
|
structure length |
78
|
Chain Sequence |
VSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVFDKEDLAEYYEEAGIHPPEPI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein
|
molecule keywords |
Diphthamide biosynthesis protein 3
|
publication title |
Hyperbolic Pressure-Temperature Phase Diagram of the Zinc-Finger Protein apoKti11 Detected by NMR Spectroscopy.
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae s288c
|
total genus |
14
|
structure length |
78
|
sequence length |
78
|
ec nomenclature | |
pdb deposition date | 2015-07-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05207 | zf-CSL | CSL zinc finger |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Microbial ribonuclease fold | DPH Zinc finger |
#chains in the Genus database with same CATH superfamily 1YOP A; 1YWS A; 4X33 A; 5AX2 A; 4D4O A; 1WGE A; 2L6L A; 4D4P A; 2JR7 A; #chains in the Genus database with same CATH topology 1YOP A; 1YWS A; 4X33 A; 5AX2 A; 4D4O A; 1WGE A; 2L6L A; 4D4P A; 2JR7 A; #chains in the Genus database with same CATH homology 1YOP A; 1YWS A; 4X33 A; 5AX2 A; 4D4O A; 1WGE A; 2L6L A; 4D4P A; 2JR7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...