The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
76
|
structure length |
76
|
Chain Sequence |
PPKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Dna binding protein/dna
|
| molecule keywords |
AncGR2 DNA Binding Domain
|
| publication title |
Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
pubmed doi rcsb |
| source organism |
Unclassified
|
| total genus |
16
|
| structure length |
76
|
| sequence length |
76
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2015-07-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00105 | zf-C4 | Zinc finger, C4 type (two domains) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Erythroid Transcription Factor GATA-1; Chain A | Erythroid Transcription Factor GATA-1, subunit A |
#chains in the Genus database with same CATH superfamily 2NLL B; 7GAT A; 4TMA I; 5EMQ A; 4OND A; 3G6Q A; 3E00 D; 4HN5 A; 5CBZ A; 1R4I A; 5CBX A; 3G6R A; 4OLN A; 2A66 A; 1DSZ A; 3G9P A; 4GAT A; 4TNT A; 1GDC A; 5CC0 A; 3G6U A; 5CBY A; 3FYL A; 2HAN A; 5CC1 A; 1RXR A; 2VUS I; 1GAU A; 5KRB B; 1A6Y A; 1HCQ A; 3G6T A; 4HC7 A; 2GAT A; 5E6C A; 1HLZ A; 4CN2 C; 3DZY A; 1R0O A; 2EBL A; 3G99 A; 3DFV C; 2NLL A; 5E6D A; 1GNF A; 2C7A A; 3DZY D; 1LAT A; 4AA6 A; 1BY4 A; 1YNW A; 3G8U A; 4HCA A; 1RGD A; 4NQA B; 5E69 A; 4HC9 A; 3M9E A; 1R4R A; 3G9O A; 1HRA A; 5L0M A; 1R0N B; 2HAN B; 1KB6 A; 4OV7 A; 1GA5 A; 2M9W A; 5EMP A; 5E6A A; 1R4O A; 3GAT A; 1GAT A; 2GDA A; 2ENV A; 3CBB A; 4CN5 A; 1LV3 A; 1KB4 A; 3G9I A; 3DFX A; 3G9M A; 3G8X A; 3VEK C; 4CN3 D; 3G97 A; 3DZU D; 6GAT A; 5GAT A; 1DSZ B; 4OOR A; 4CN7 A; 5EMC A; 1KB2 A; 1YNW B; 4CN3 A; 1HCP A; 4IQR A; 5E6B A; 1LO1 A; 2KAE A; 3DZU A; 1R0N A; 1CIT A; 4HN6 A; 1R0O B; 1GLU A; 3VD6 C; 2FF0 A; 3E00 A; 3G6P A; 2VUT I; 3G9J A; 2VUU I; #chains in the Genus database with same CATH topology 2NLL B; 7GAT A; 4TMA I; 5EMQ A; 4OND A; 3G6Q A; 3E00 D; 4HN5 A; 5CBZ A; 1R4I A; 5CBX A; 3G6R A; 4OLN A; 2A66 A; 1DSZ A; 3G9P A; 4GAT A; 4TNT A; 1GDC A; 5CC0 A; 3G6U A; 5CBY A; 3FYL A; 2HAN A; 5CC1 A; 1RXR A; 2VUS I; 1GAU A; 2DS6 A; 5KRB B; 1A6Y A; 1HCQ A; 3G6T A; 4HC7 A; 2GAT A; 5E6C A; 1HLZ A; 4CN2 C; 3DZY A; 1R0O A; 2EBL A; 3G99 A; 3DFV C; 2NLL A; 5E6D A; 1GNF A; 2C7A A; 3DZY D; 1LAT A; 4AA6 A; 1BY4 A; 1YNW A; 2DS8 A; 3G8U A; 4HCA A; 1RGD A; 4NQA B; 5E69 A; 4HC9 A; 3M9E A; 1R4R A; 3G9O A; 1HRA A; 5L0M A; 1R0N B; 2HAN B; 1KB6 A; 4OV7 A; 1GA5 A; 2M9W A; 5EMP A; 5E6A A; 3G27 A; 1R4O A; 3GAT A; 1GAT A; 2GDA A; 2ENV A; 3CBB A; 4CN5 A; 1LV3 A; 1KB4 A; 3G9I A; 3DFX A; 3G9M A; 3G8X A; 3VEK C; 4CN3 D; 3G97 A; 3DZU D; 6GAT A; 5GAT A; 1DSZ B; 2DS5 A; 4OOR A; 4CN7 A; 5EMC A; 1KB2 A; 1YNW B; 4CN3 A; 1HCP A; 4IQR A; 5E6B A; 1LO1 A; 2KAE A; 3DZU A; 1R0N A; 1CIT A; 4HN6 A; 1R0O B; 1GLU A; 3VD6 C; 2FF0 A; 3E00 A; 3G6P A; 2VUT I; 3G9J A; 2VUU I; #chains in the Genus database with same CATH homology 2NLL B; 7GAT A; 4TMA I; 5EMQ A; 4OND A; 3G6Q A; 3E00 D; 4HN5 A; 5CBZ A; 1R4I A; 5CBX A; 3G6R A; 4OLN A; 2A66 A; 1DSZ A; 3G9P A; 4GAT A; 4TNT A; 1GDC A; 5CC0 A; 3G6U A; 5CBY A; 3FYL A; 2HAN A; 5CC1 A; 1RXR A; 2VUS I; 1GAU A; 5KRB B; 1A6Y A; 1HCQ A; 3G6T A; 4HC7 A; 2GAT A; 5E6C A; 1HLZ A; 4CN2 C; 3DZY A; 1R0O A; 2EBL A; 3G99 A; 3DFV C; 2NLL A; 5E6D A; 1GNF A; 2C7A A; 3DZY D; 1LAT A; 4AA6 A; 1BY4 A; 1YNW A; 3G8U A; 4HCA A; 1RGD A; 4NQA B; 5E69 A; 4HC9 A; 3M9E A; 1R4R A; 3G9O A; 1HRA A; 5L0M A; 1R0N B; 2HAN B; 1KB6 A; 4OV7 A; 1GA5 A; 2M9W A; 5EMP A; 5E6A A; 1R4O A; 3GAT A; 1GAT A; 2GDA A; 2ENV A; 3CBB A; 4CN5 A; 1LV3 A; 1KB4 A; 3G9I A; 3DFX A; 3G9M A; 3G8X A; 3VEK C; 4CN3 D; 3G97 A; 3DZU D; 6GAT A; 5GAT A; 1DSZ B; 4OOR A; 4CN7 A; 5EMC A; 1KB2 A; 1YNW B; 4CN3 A; 1HCP A; 4IQR A; 5E6B A; 1LO1 A; 2KAE A; 3DZU A; 1R0N A; 1CIT A; 4HN6 A; 1R0O B; 1GLU A; 3VD6 C; 2FF0 A; 3E00 A; 3G6P A; 2VUT I; 3G9J A; 2VUU I;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
