The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
148
|
structure length |
139
|
Chain Sequence |
PTIRKYVQSWQKLDVDEQLALFWFIYKEMGGSTVSPAIAEGLFNQVKELNHEQQLQLQRDLIRRVDNQLSREYGSLGDTTKLLFWYLLSQGMDNATIVPFPADYKLSSESQELLEGIKGLGFEQQITLFRDYVSPMGAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Cartenoid binding protein
|
| molecule keywords |
Red carotenoid protein (RCP)
|
| publication title |
Structure, Diversity, and Evolution of a New Family of Soluble Carotenoid-Binding Proteins in Cyanobacteria.
pubmed doi rcsb |
| source organism |
Nostoc sp.
|
| total genus |
50
|
| structure length |
139
|
| sequence length |
148
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2015-12-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09150 | Carot_N | Orange carotenoid protein, N-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | orange carotenoid protein, domain 2 | Orange carotenoid-binding protein, N-terminal domain |
#chains in the Genus database with same CATH superfamily 4XB5 A; 5FCY A; 4XB4 A; 5FCX A; 3MG1 A; 5HGR A; 3MG2 A; 3MG3 A; #chains in the Genus database with same CATH topology 4XB5 A; 5FCY A; 4XB4 A; 5FCX A; 3MG1 A; 5HGR A; 3MG2 A; 3MG3 A; #chains in the Genus database with same CATH homology 4XB5 A; 5FCY A; 4XB4 A; 5FCX A; 3MG1 A; 5HGR A; 3MG2 A; 3MG3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
