The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
48
|
structure length |
48
|
Chain Sequence |
AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Dna binding protein
|
molecule keywords |
AbrB family transcriptional regulator
|
publication title |
The Arginine Pairs and C-Termini of the Sso7c4 from Sulfolobus solfataricus Participate in Binding and Bending DNA.
pubmed doi rcsb |
source organism |
Sulfolobus solfataricus
|
total genus |
3
|
structure length |
48
|
sequence length |
48
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2016-03-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04014 | MazE_antitoxin | Antidote-toxin recognition MazE, bacterial antitoxin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Pemi-like Protein 1; Chain: D | Pemi-like Protein 1; Chain: D |
#chains in the Genus database with same CATH superfamily 1MVF D; 2W1T A; 2K1N A; 2RO4 A; 2GLW A; 2RO5 A; 2RO3 A; 2L66 A; 2FY9 A; 3O27 A; 5ITJ A; 3TND B; 2W1T B; 5ITM A; 1Z0R A; 1UB4 C; 1YSF A; 1YFB A; #chains in the Genus database with same CATH topology 2RO3 A; 2L66 A; 4JDM A; 3O27 A; 2W1T B; 2QA4 I; 1Z0R A; 2K1N A; 5ITM A; 1MVF D; 2RO5 A; 5ITJ A; 1YFB A; 2W1T A; 2RO4 A; 2GLW A; 4JDO A; 2FY9 A; 3TND B; 1UB4 C; 1YSF A; #chains in the Genus database with same CATH homology 2RO3 A; 2L66 A; 4JDM A; 3O27 A; 2W1T B; 2QA4 I; 1Z0R A; 2K1N A; 5ITM A; 1MVF D; 2RO5 A; 5ITJ A; 1YFB A; 2W1T A; 2RO4 A; 2GLW A; 4JDO A; 2FY9 A; 3TND B; 1UB4 C; 1YSF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...