The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
7
|
sequence length |
71
|
structure length |
46
|
Chain Sequence |
LYMAAAVMMGLAAIGAAIQFFIVMGLVDAIPMICVGLGLYVMFAVA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
molecule keywords |
F1F0 ATP SYNTHASE (SUBUNIT C)
|
publication title |
Determination of local protein structure by spin label difference 2D NMR: the region neighboring Asp61 of subunit c of the F1F0 ATP synthase.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
7
|
structure length |
46
|
sequence length |
71
|
ec nomenclature |
ec
3.6.1.34: Transferred entry: 7.1.2.2. |
pdb deposition date | 1994-10-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00137 | ATP-synt_C | ATP synthase subunit C |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | F1FO ATP Synthase | F1F0 ATP synthase subunit C |
#chains in the Genus database with same CATH superfamily 2WIE A; 2WPD J; 4BEM A; 5BQA A; 5BQ6 A; 2XQS A; 2W5J A; 3U2F K; 3U2Y K; 1A91 A; 5BQJ A; 1C17 A; 3ZK1 A; 5FL7 K; 4V1F A; 1YCE A; 4CBJ C; 1ATY A; 3ZK2 A; 2X2V A; 2XOK K; 4V1G A; 1WU0 A; 4CBJ A; 3V3C A; 1C99 A; 2XQU A; 5BPS A; 1L6T A; 2XND J; 2XQT A; 4F4S A; 1IJP A; 3UD0 K; 5DN6 J; 4V1H A; 3U32 K; 4CBK A; 1C0V A; 2WGM A; #chains in the Genus database with same CATH topology 2WIE A; 2WPD J; 4BEM A; 5BQA A; 5BQ6 A; 2XQS A; 2W5J A; 3U2F K; 3U2Y K; 1A91 A; 5BQJ A; 1C17 A; 3ZK1 A; 5FL7 K; 4V1F A; 1YCE A; 4CBJ C; 1ATY A; 3NB0 A; 3ZK2 A; 2X2V A; 2XOK K; 4V1G A; 1WU0 A; 4CBJ A; 3MAY A; 3V3C A; 1C99 A; 2XQU A; 5BPS A; 1L6T A; 2XND J; 2XQT A; 4F4S A; 1IJP A; 3UD0 K; 5DN6 J; 4V1H A; 3U32 K; 4CBK A; 1C0V A; 2WGM A; #chains in the Genus database with same CATH homology 2WIE A; 2WPD J; 4BEM A; 5BQA A; 5BQ6 A; 2XQS A; 2W5J A; 3U2F K; 3U2Y K; 1A91 A; 5BQJ A; 1C17 A; 3ZK1 A; 5FL7 K; 4V1F A; 1YCE A; 4CBJ C; 1ATY A; 3ZK2 A; 2X2V A; 2XOK K; 4V1G A; 1WU0 A; 4CBJ A; 3V3C A; 1C99 A; 2XQU A; 5BPS A; 1L6T A; 2XND J; 2XQT A; 4F4S A; 1IJP A; 3UD0 K; 5DN6 J; 4V1H A; 3U32 K; 4CBK A; 1C0V A; 2WGM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...