The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
56
|
structure length |
56
|
Chain Sequence |
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ribosome
|
molecule keywords |
50S RIBOSOMAL PROTEIN L9
|
publication title |
Effects of varying the local propensity to form secondary structure on the stability and folding kinetics of a rapid folding mixed alpha/beta protein: characterization of a truncation mutant of the N-terminal domain of the ribosomal protein L9.
pubmed doi rcsb |
total genus |
9
|
structure length |
56
|
sequence length |
56
|
ec nomenclature | |
pdb deposition date | 1999-08-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01281 | Ribosomal_L9_N | Ribosomal protein L9, N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Ribosomal Protein L9; domain 1 | Ribosomal protein L9, N-terminal domain |
#chains in the Genus database with same CATH superfamily 2HVF A; 4UY8 H; 3J7Z H; 2HBA A; 2HBB A; 1CQU A; 1DIV A; #chains in the Genus database with same CATH topology 3FNV A; 4OO7 A; 2LSM A; 2Q9Q B; 5EG5 A; 3CO4 A; 4FS8 A; 3FND A; 4KW7 A; 4F2C A; 2OUT A; 4FR0 A; 2HJQ A; 3J7Z H; 2X4A A; 2HBA A; 3LPQ A; 2HBB A; 2E9X D; 2EHO C; 3REE A; 2E9X B; 3EW0 A; 4EZF A; 4UY8 H; 3TBO A; 4F1E A; 1CQU A; 1DIV A; 2R13 A; 2Q9Q A; 4RSR A; 5GHS C; 3S2Q A; 5GHR B; 2HVF A; 2QH7 A; 3ANW A; 3S2R A; 2X49 A; 3TBN A; 2QD0 A; 4OOA A; 4F28 A; 4FSD A; #chains in the Genus database with same CATH homology 2HVF A; 4UY8 H; 3J7Z H; 2HBA A; 2HBB A; 1CQU A; 1DIV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...