The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
64
|
structure length |
64
|
Chain Sequence |
GINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSGTFPLCDGSCVKHNKANGDNVGPLLLKKQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein
|
molecule keywords |
AT5g51720/MIO24_14
|
publication title |
Arabidopsis thaliana ChloroNEET, a Member of the New NEET Family of Human Proteins, is Involved in Development, Senescence and Iron Metabolism.
rcsb |
source organism |
Arabidopsis thaliana
|
total genus |
13
|
structure length |
64
|
sequence length |
64
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-05-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09360 | zf-CDGSH | Iron-binding zinc finger CDGSH type |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Ribosomal Protein L9; domain 1 | Ribosomal Protein L9; domain 1 |
#chains in the Genus database with same CATH superfamily 4EZF A; 3LPQ A; 3S2R A; 2QD0 A; 4OOA A; 3FNV A; 3S2Q A; 3TBO A; 3TBN A; 4F1E A; 2QH7 A; 4F28 A; 3EW0 A; 4F2C A; 3REE A; 2R13 A; 4OO7 A; #chains in the Genus database with same CATH topology 4EZF A; 2LSM A; 3FNV A; 3TBN A; 2QH7 A; 4F28 A; 3EW0 A; 2EHO C; 5GHS C; 5GHR B; 2HBB A; 3S2Q A; 1DIV A; 3LPQ A; 2X4A A; 4F1E A; 2HVF A; 3REE A; 3J7Z H; 1CQU A; 2Q9Q A; 4FSD A; 2R13 A; 2X49 A; 2OUT A; 2HJQ A; 2QD0 A; 4UY8 H; 2E9X D; 4KW7 A; 2Q9Q B; 4FS8 A; 2HBA A; 2E9X B; 4OO7 A; 3S2R A; 4OOA A; 3TBO A; 4F2C A; 5EG5 A; 4FR0 A; 3CO4 A; 4RSR A; 3FND A; 3ANW A; #chains in the Genus database with same CATH homology 4EZF A; 2LSM A; 3FNV A; 3TBN A; 2QH7 A; 4F28 A; 3EW0 A; 2EHO C; 5GHS C; 5GHR B; 3S2Q A; 3LPQ A; 2X4A A; 4F1E A; 3REE A; 2Q9Q A; 4FSD A; 2R13 A; 2X49 A; 2OUT A; 2QD0 A; 2E9X D; 4KW7 A; 2Q9Q B; 4FS8 A; 2E9X B; 4OO7 A; 3S2R A; 4OOA A; 3TBO A; 4F2C A; 5EG5 A; 4FR0 A; 4RSR A; 3ANW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...