1O84A

Crystal structure of bacteriocin as-48. n-decyl-beta-d-maltoside bound.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide antibiotic
molecule keywords PEPTIDE ANTIBIOTIC AS-48
publication title Structure of Bacteriocin as-48: From Soluble State to Membrane Bound State
pubmed doi rcsb
total genus 25
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09221 Bacteriocin_IId Bacteriocin class IId cyclical uberolysin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.225.10 Mainly Alpha Up-down Bundle Bacteriocin As-48; Chain A Bacteriocin AS-48 1o84A00
1O82A 4RGDA 1E68A 1O84A 2KJFA 2MP8A 1O83A
chains in the Genus database with same CATH superfamily
2KSNA 4YCOA 4YCPA 1O82A 4RGDA 4BF9A 1E68A 1O84A 2KJFA 3W9ZA 2MP8A 1O83A 4BFAA
chains in the Genus database with same CATH topology
1O82A 4RGDA 1E68A 1O84A 2KJFA 2MP8A 1O83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O82 A;  4RGD A;  1E68 A;  1O84 A;  2KJF A;  2MP8 A;  1O83 A; 
#chains in the Genus database with same CATH topology
 2KSN A;  4YCO A;  4YCP A;  1O82 A;  4RGD A;  4BF9 A;  1E68 A;  1O84 A;  2KJF A;  3W9Z A;  2MP8 A;  1O83 A;  4BFA A; 
#chains in the Genus database with same CATH homology
 1O82 A;  4RGD A;  1E68 A;  1O84 A;  2KJF A;  2MP8 A;  1O83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...