The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
93
|
structure length |
93
|
Chain Sequence |
VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHNVGRS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Lipase protein cofactor
|
molecule keywords |
PORCINE PANCREATIC PROCOLIPASE B
|
publication title |
Solution structure of porcine pancreatic procolipase as determined from 1H homonuclear two-dimensional and three-dimensional NMR.
pubmed doi rcsb |
source organism |
Sus scrofa
|
total genus |
19
|
structure length |
93
|
sequence length |
93
|
ec nomenclature | |
pdb deposition date | 1994-06-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01114 | Colipase | Colipase, N-terminal domain |
A | PF02740 | Colipase_C | Colipase, C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Lipase, subunit A | Lipase, subunit A |
#chains in the Genus database with same CATH superfamily 1PCN A; 1ETH B; 2JTK A; 1N8S C; 1PCO A; 3S8V X; 1LPA A; 2N8K A; 5FWW C; 3S2K C; 1LPB A; 1IMT A; 2KRA A; #chains in the Genus database with same CATH topology 1PCN A; 1ETH B; 2JTK A; 1N8S C; 1PCO A; 3S8V X; 1LPA A; 2N8K A; 5FWW C; 3S2K C; 1LPB A; 1IMT A; 3BT4 A; 2KRA A; #chains in the Genus database with same CATH homology 1PCN A; 1ETH B; 2JTK A; 1N8S C; 1PCO A; 3S8V X; 1LPA A; 2N8K A; 5FWW C; 3S2K C; 1LPB A; 1IMT A; 3BT4 A; 2KRA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...